Copy Link Print Information

SPEB Protein, E.coli (His-SUMO)

Customer Review

Based on 1 Customer Validation

The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • SPEB Protein, E.coli (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

SPEB, or agmatine ureohydrolase, is an enzyme that catalyzes the formation of putrescine from agmatine. This enzymatic reaction is a crucial step in the biosynthetic pathway of polyamines. Putrescine is a diamine that serves as a precursor for the synthesis of higher polyamines, such as spermidine and spermine, which are essential for various cellular processes, including cell growth, differentiation, and nucleic acid stabilization. By converting agmatine into putrescine, SPEB plays a central role in regulating polyamine levels, influencing cellular functions critical for growth and development. It has to succinctly outline SPEB's specific catalytic activity in the biosynthesis of putrescine, emphasizing its importance in the polyamine metabolic pathway.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession

    B7LFJ6 (M1-E306)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • SPEB (M1-E306)
      Accession # B7LFJ6
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Streptopain; EC:3.4.22.10; Exotoxin type B; Group A streptococcal cysteine protease; Streptococcal cysteine proteinase; Streptococcal cysteine proteinase; SPE B; Streptococcus peptidase A; SPP; speB

  • AA Sequence

    MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE

  • Predicted Molecular Mass

    49.5 kDa

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SPEB Protein, E.coli (His-SUMO) Product Image
    1/16
  • SPEB Protein, E.coli (His-SUMO) Product Image