SPG21 Protein, Mouse (sf9, His)

The SPG21 protein acts as a negative regulator in CD4-dependent T cell activation, suggesting a potential role in the regulation of immune responses. By interacting directly with CD4, it affects key components of the T cell activation pathway. SPG21 Protein, Mouse (sf9, His) is the recombinant mouse-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

The SPG21 protein appears to function as a negative regulatory factor in CD4-dependent T-cell activation, suggesting a potential role in modulating immune responses. This regulatory function involves direct interactions with CD4, emphasizing its influence on key components of the T-cell activation pathway. Additionally, SPG21 protein interacts with ALDH16A1, indicating its involvement in diverse molecular interactions that may extend beyond T-cell regulation. Further exploration into the specific mechanisms and downstream effects of SPG21 in the context of CD4-dependent T-cell activation could provide valuable insights into its role in immune modulation and cellular processes beyond the immune system.

Mouse

Sf9 insect cells

N-6*His

Q9CQC8-1 (M1-P308)

27965  [NCBI]

Full Length of Isoform-1

MGEIKVSPDYNWFRSTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFQQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNAFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, 50% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.