ST2/IL1RL1 Protein, Human (HEK293, Fc)

ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (HEK293, Fc) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-hFc labeled tag.

ST2/IL1RL1 protein serves as a potent inhibitor of IL-33 signaling.

1.Immobilized Human IL-33, No Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Human IL-1RL1, hFc Tag with the EC₅₀ of ≤9.9 ng/mL determined by ELISA.
2.Immobilized Human IL-33, No Tag at 5 μg/mL(100 μL/well) on the plate. Dose response curve for Human IL-1RL1, hFc Tag with the EC₅₀ of 5-10 ng/mL determined by ELISA.

Human

HEK293

C-hFc

Q01638-2 (K19-F328)

9173  [NCBI]

Extracellular Domain

KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

75-100 kDa

≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/baf3-cell.html  [Content Brief]