1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Staphopain B Protein, S. aureus (GST)

Staphopain B Protein, S. aureus (GST)

Cat. No.: HY-P71624
SDS COA Handling Instructions

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

Background

Staphopain B, a cysteine protease, assumes a pivotal role in undermining the host innate immune response by targeting various host proteins. It exhibits the ability to degrade host elastin, fibrogen, fibronectin, and kininogen. Furthermore, Staphopain B interferes with the host's defense mechanisms by impeding the phagocytosis of opsonized S. aureus through the induction of death in neutrophils and monocytes in a proteolytic activity-dependent manner. This inhibition extends to the downregulation of the 'don't eat me' signal CD31 on neutrophils. Additionally, Staphopain B cleaves host galectin-3/LGALS3, thereby thwarting the neutrophil-activating capabilities of this lectin. Notably, the premature activation/folding of Staphopain B can be regulated by staphostatin B (SspC), which likely serves a protective role by preventing the degradation of staphylococcal cytoplasmic proteins by SspB.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Staphylococcus aureus

Source

E. coli

Tag

N-GST

Accession

Q99V46 (D220-Y393)

Gene ID

/

Molecular Construction
N-term
GST
Staphopain B (D220-Y393)
Accession # Q99V46
C-term
Synonyms
sspB; SAV1047; Staphopain B; EC 3.4.22.-; Staphylococcal cysteine proteinase B; Staphylopain B
AA Sequence

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Molecular Weight

Approximately 46.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Staphopain B Protein, S. aureus (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Staphopain B Protein, S. aureus (GST)
Cat. No.:
HY-P71624
Quantity:
MCE Japan Authorized Agent: