Copy Link Print Information

Staphopain B Protein, S. aureus (GST)

Customer Review

Based on 1 Customer Validation

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Staphylococcus aureus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Staphopain B Protein, S. aureus (GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

Background

Staphopain B, a cysteine protease, assumes a pivotal role in undermining the host innate immune response by targeting various host proteins. It exhibits the ability to degrade host elastin, fibrogen, fibronectin, and kininogen. Furthermore, Staphopain B interferes with the host's defense mechanisms by impeding the phagocytosis of opsonized S. aureus through the induction of death in neutrophils and monocytes in a proteolytic activity-dependent manner. This inhibition extends to the downregulation of the 'don't eat me' signal CD31 on neutrophils. Additionally, Staphopain B cleaves host galectin-3/LGALS3, thereby thwarting the neutrophil-activating capabilities of this lectin. Notably, the premature activation/folding of Staphopain B can be regulated by staphostatin B (SspC), which likely serves a protective role by preventing the degradation of staphylococcal cytoplasmic proteins by SspB.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Staphylococcus aureus
  • Source E. coli
  • Tag N-GST
  • Accession

    Q99V46 (D220-Y393)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • GST
    • Staphopain B (D220-Y393)
      Accession # Q99V46
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Staphopain B; EC:3.4.22.-; Staphylococcal cysteine proteinase B; Staphylopain B; sspB; SAV1047

  • AA Sequence

    DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

  • Predicted Molecular Mass

    46.9 kDa

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Staphopain B Protein, S. aureus (GST) Product Image
    1/16
  • Staphopain B Protein, S. aureus (GST) Product Image