Staphopain B Protein, S. aureus (GST)

Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag. The total length of Staphopain B Protein, S. aureus (GST) is 174 a.a., with molecular weight of ~46.9 kDa.

Staphopain B, a cysteine protease, assumes a pivotal role in undermining the host innate immune response by targeting various host proteins. It exhibits the ability to degrade host elastin, fibrogen, fibronectin, and kininogen. Furthermore, Staphopain B interferes with the host's defense mechanisms by impeding the phagocytosis of opsonized S. aureus through the induction of death in neutrophils and monocytes in a proteolytic activity-dependent manner. This inhibition extends to the downregulation of the 'don't eat me' signal CD31 on neutrophils. Additionally, Staphopain B cleaves host galectin-3/LGALS3, thereby thwarting the neutrophil-activating capabilities of this lectin. Notably, the premature activation/folding of Staphopain B can be regulated by staphostatin B (SspC), which likely serves a protective role by preventing the degradation of staphylococcal cytoplasmic proteins by SspB.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Staphylococcus aureus

E. coli

N-GST

Q99V46 (220D-393Y)

/

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Approximately 46.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.