STAT6 Protein, Human (His)
Based on 1 Customer Validation
STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.
STAT6 (Signal Transducer and Activator of Transcription 6) is a multifunctional protein that plays a dual role in signal transduction and transcriptional activation. It is particularly involved in mediating signaling pathways triggered by interleukin-4 (IL-4) and interleukin-3 (IL-3). STAT6 can form homodimers or heterodimers with related family members, facilitating its engagement in various cellular processes. Additionally, STAT6 interacts with the nuclear receptor coactivator NCOA1 through its C-terminal LXXLL motif, suggesting a potential role in modulating gene expression. This interaction further underscores STAT6's involvement in transcriptional regulation, highlighting its versatility in coordinating signaling events and transcriptional responses in cellular pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P42226 (S627-S837)
-
Molecular Construction
-
N-term
-
STAT6 (S627-S837)
Accession # P42226 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
STAT6; Transcription Factor IL-4 STAT; Signal Transducer And Activator Of Transcription 6; STAT, Interleukin4-Induced; IL-4-STAT; IL-4 Stat; D12S1644; STAT6B; Signal Transducer And Activator Of Transcription 6, Interleukin-4 Induced; STAT6C; Signal Transd
-
AA Sequence
SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS
-
Predicted Molecular Mass
23.9 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)