Stathmin Protein, Human (His)

Stathmin Protein, a widely distributed cytosolic phosphoprotein, integrates regulatory signals and destabilizes microtubules, crucial for their assembly and disassembly. It exhibits broad expression in various tissues, highlighting its versatile role in cellular processes. Stathmin Protein, Human (His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Stathmin Protein, Human (His) is 149 a.a., with molecular weight of ~19 kDa.

Stathmin, a member of the stathmin gene family, encodes a widely distributed cytosolic phosphoprotein with proposed functions as an intracellular relay, integrating regulatory signals from the cellular environment. Known for its involvement in the regulation of the microtubule filament system, the encoded protein exerts its influence by destabilizing microtubules, thus playing a crucial role in their assembly and disassembly. With multiple transcript variants giving rise to distinct isoforms, Stathmin showcases broad expression, emphasizing its significance in various tissues, including the brain and testis, and suggesting its versatile role in cellular processes.

Data is not available

Human

E. coli

N-6*His

NP_005554.1 (M1-D149)

3925  [NCBI]

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Approximately 19 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.