1. Recombinant Proteins
  2. Others
  3. Stratifin Protein, Human (N-His, C-Myc)

Stratifin Protein, Human (N-His, C-Myc)

Cat. No.: HY-P700308
COA Handling Instructions

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein, engaging in diverse cellular processes by binding to partners via phosphoserine or phosphothreonine motifs. It regulates epithelial cell growth and protein synthesis with keratin 17 (KRT17) and potentially influences MDM2 autoubiquitination, activating p53. As a homodimer, it interacts in various complexes with proteins like GAB2, SAMSN1, SRPK2, COPS6, COP1, DAPK2, PI4KB, SLITRK1, and LRRK2, highlighting its versatile role in cellular processes and signaling pathways. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli, with N-10*His, C-Myc labeled tag. The total length of Stratifin Protein, Human (N-His, C-Myc) is 248 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $120 In-stock
50 μg $260 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein, engaging in diverse cellular processes by binding to partners via phosphoserine or phosphothreonine motifs. It regulates epithelial cell growth and protein synthesis with keratin 17 (KRT17) and potentially influences MDM2 autoubiquitination, activating p53. As a homodimer, it interacts in various complexes with proteins like GAB2, SAMSN1, SRPK2, COPS6, COP1, DAPK2, PI4KB, SLITRK1, and LRRK2, highlighting its versatile role in cellular processes and signaling pathways. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli, with N-10*His, C-Myc labeled tag. The total length of Stratifin Protein, Human (N-His, C-Myc) is 248 a.a., with molecular weight of ~34 kDa.

Background

Stratifin, also known as 14-3-3 sigma, encoded by the SFN gene, is a multifunctional protein belonging to the 14-3-3 family. It serves as an adapter protein, engaging in diverse cellular processes by binding to numerous partners through the recognition of phosphoserine or phosphothreonine motifs. Its pivotal roles include regulation of epithelial cell growth and protein synthesis when bound to keratin 17 (KRT17), as well as potential involvement in MDM2 autoubiquitination and degradation, leading to the activation of the tumor suppressor p53. Existing as a homodimer and participating in various protein complexes, stratifin interacts with a wide array of proteins, such as GAB2, SAMSN1, SRPK2, COPS6, COP1, DAPK2, PI4KB, SLITRK1, and LRRK2, showcasing its versatility in orchestrating crucial cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P31947 (M1-S248)

Gene ID
Molecular Construction
N-term
10*His
Stratifin (M1-S248)
Accession # P31947
Myc
C-term
Synonyms
14-3-3 Protein Sigma; Epithelial Cell Marker Protein 1; Stratifin; SFN; HME1
AA Sequence

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Weight

Approximately 34 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Stratifin Protein, Human (N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Stratifin Protein, Human (N-His, C-Myc)
Cat. No.:
HY-P700308
Quantity:
MCE Japan Authorized Agent: