SULT1A3 Protein, Human (His)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1A3 Protein, Human (His) is 295 a.a., with molecular weight of ~35.0 kDa.

SULT1A3 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing the sulfate conjugation of phenolic monoamines, including neurotransmitters such as dopamine, norepinephrine, and serotonin, as well as phenolic and catechol drugs. This enzymatic activity contributes significantly to the inactivation and elimination of these bioactive molecules, highlighting SULT1A3's crucial role in regulating the levels and activity of neurotransmitters and certain pharmacologically relevant compounds. The substrate specificity of SULT1A3 underscores its importance in modulating physiological responses to neurotransmitters and drugs, emphasizing its significance in maintaining homeostasis and proper functioning of biological systems.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P0DMM9 (M1-L295)

445329  [NCBI]

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Approximately 35.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.