SULT1C4 Protein, Human (His)

The SULT1C4 protein is an important member of the sulfotransferase 1 family and plays a crucial role in phase II drug metabolism and binding of endogenous compounds. Its research enhances the understanding of xenobiotic metabolism and has potential applications in pharmacology. SULT1C4 Protein, Human (His) is the recombinant human-derived SULT1C4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1C4 Protein, Human (His) is 102 a.a., with molecular weight of ~14.0 kDa.

The SULT1C4 Protein is a vital member of the sulfotransferase 1 family, underscoring its crucial role in phase II drug metabolism and the conjugation of various endogenous compounds. As part of this family, SULT1C4 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the transfer of sulfate groups to substrates. The classification within the sulfotransferase 1 family underscores its specific designation within the broader context of enzymes involved in sulfate conjugation, providing insights into its unique catalytic functions. The study of SULT1C4 contributes to our understanding of its role in cellular processes related to detoxification and the regulation of biological activities, offering potential applications in pharmacology and a deeper comprehension of its broader impact on xenobiotic metabolism. Further exploration of SULT1C4's role holds promise for enhancing our knowledge of its contributions to both normal physiology and responses to chemical exposure.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q6PD90 (M1-K102)

27233  [NCBI]

MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM NaAc, pH 4.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.