SUMO2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Small ubiquitin-related modifier 2 (SUMO2) is a ubiquitin-like protein that covalently attached to proteins as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 Protein, Human (His) is the recombinant human-derived SUMO2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Small ubiquitin-related modifier 2 (SUMO2) is a ubiquitin-like protein that covalently attached to proteins as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 Protein, Human (His) is the recombinant human-derived SUMO2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Small ubiquitin-related modifier 2 (SUMO2) is a member of the SUMO protein family. SUMO2 is a ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. SUMO2 also plays a role in the regulation of sumoylation status of SETX.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • SUMO2 (M1-G93)
      Accession # AAH08450.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SUMO2; SMT3 (Suppressor Of Mif Two 3, Yeast) Homolog 2; Prev. SMT3H2; SMT3 Suppressor Of Mif Two 3 Homolog 2; SMT3B; Sentrin 2; Small Ubiquitin-Related Modifier 2; Sentrin-2; Ubiquitin-Like Protein SMT3B; SUMO-3; SMT3 Homolog 2; SUMO-2; HSMT3; Smt3B; SMT3

  • AA Sequence

    MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00