1. Recombinant Proteins
  2. Others
  3. SUMO2 Protein, Human (His)

SUMO2 Protein, Human (His)

Cat. No.: HY-P70974
COA Handling Instructions

Small ubiquitin-related modifier 2 (SUMO2) is a ubiquitin-like protein that covalently attached to proteins as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 Protein, Human (His) is the recombinant human-derived SUMO2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SUMO2 Protein, Human (His) is 93 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $35 In-stock
50 μg $98 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Small ubiquitin-related modifier 2 (SUMO2) is a ubiquitin-like protein that covalently attached to proteins as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 Protein, Human (His) is the recombinant human-derived SUMO2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SUMO2 Protein, Human (His) is 93 a.a., with molecular weight of ~17.0 kDa.

Background

Small ubiquitin-related modifier 2 (SUMO2) is a member of the SUMO protein family. SUMO2 is a ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. SUMO2 also plays a role in the regulation of sumoylation status of SETX.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH08450.1 (M1-G93)

Gene ID
Molecular Construction
N-term
6*His
SUMO2 (M1-G93)
Accession # AAH08450.1
C-term
Synonyms
Small Ubiquitin-Related Modifier 2; SUMO-2; HSMT3; SMT3 homolog 2; SUMO-3; Sentrin-2; Ubiquitin-Like Protein SMT3A; Smt3A; SUMO2; SMT3A; SMT3H2
AA Sequence

MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SUMO2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SUMO2 Protein, Human (His)
Cat. No.:
HY-P70974
Quantity:
MCE Japan Authorized Agent: