1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. SVMP Protein, Crotalus adamanteus (His)

SVMP Protein, Crotalus adamanteus (His)

Cat. No.: HY-P71455
SDS COA Handling Instructions

SVMP protein, while lacking significant hemorrhagic activity, functions by inactivating serpins through limited proteolysis of their reactive-site loops. SVMP Protein, Crotalus adamanteus (His) is the recombinant SVMP protein, expressed by E. coli , with N-6*His labeled tag. The total length of SVMP Protein, Crotalus adamanteus (His) is 203 a.a., with molecular weight of ~27.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SVMP protein, while lacking significant hemorrhagic activity, functions by inactivating serpins through limited proteolysis of their reactive-site loops. SVMP Protein, Crotalus adamanteus (His) is the recombinant SVMP protein, expressed by E. coli , with N-6*His labeled tag. The total length of SVMP Protein, Crotalus adamanteus (His) is 203 a.a., with molecular weight of ~27.1 kDa.

Background

The SVMP protein exhibits no significant hemorrhagic activity; however, it operates by inactivating serpins through limited proteolysis of their reactive-site loops.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P34179 (1Q-203P)

Gene ID

/

Molecular Construction
N-term
6*His
SVMP (1Q-203P)
Accession # P34179
C-term
Synonyms
Snake venom metalloproteinase adamalysin-2; SVMP; EC 3.4.24.46; Adamalysin II; Proteinase II
AA Sequence

QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP

Molecular Weight

Approximately 27.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SVMP Protein, Crotalus adamanteus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SVMP Protein, Crotalus adamanteus (His)
Cat. No.:
HY-P71455
Quantity:
MCE Japan Authorized Agent: