SVMP Protein, Crotalus adamanteus (His)
Based on 1 Customer Validation
SVMP protein, while lacking significant hemorrhagic activity, functions by inactivating serpins through limited proteolysis of their reactive-site loops. SVMP Protein, Crotalus adamanteus (His) is the recombinant SVMP protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SVMP protein, while lacking significant hemorrhagic activity, functions by inactivating serpins through limited proteolysis of their reactive-site loops. SVMP Protein, Crotalus adamanteus (His) is the recombinant SVMP protein, expressed by E. coli , with N-6*His labeled tag.
Background
The SVMP protein exhibits no significant hemorrhagic activity; however, it operates by inactivating serpins through limited proteolysis of their reactive-site loops.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
P34179 (Q1-P203)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
SVMP (Q1-P203)
Accession # P34179 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Snake venom metalloproteinase adamalysin-2; EC:3.4.24.46; SVMP; Adamalysin II; Proteinase II
-
AA Sequence
QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
-
Predicted Molecular Mass
27.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
