SYNGAP1 Protein, Human (His)

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag. The total length of SYNGAP1 Protein, Human (His) is 183 a.a., with molecular weight of ~25.5 kDa.

SYNGAP1 Protein takes center stage as a major constituent of the postsynaptic density (PSD), playing a crucial role in postsynaptic signaling. Functioning as an inhibitory regulator of the Ras-cAMP pathway, SYNGAP1 is integral to synaptic function and plasticity. Within the excitatory synapses, it serves as a member of the NMDAR signaling complex, potentially influencing NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking, and overall synaptic plasticity. Furthermore, SYNGAP1 regulates AMPAR-mediated miniature excitatory postsynaptic currents and exhibits dual GTPase-activating specificity for both Ras and Rap. Interactions with KLHL17, CAMK2A, CAMK2B, and MPDZ highlight its intricate network within synaptic signaling pathways. Notably, it may be implicated in certain forms of brain injury, leading to long-term deficits in learning and memory, underscoring its critical role in neural function.

Human

E. coli

N-His

Q96PV0 (1161M-1343H)

8831  [NCBI]

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Approximately 25.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.