SYNGAP1 Protein, Human (His)
Based on 1 Customer Validation
SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.
Background
SYNGAP1 Protein takes center stage as a major constituent of the postsynaptic density (PSD), playing a crucial role in postsynaptic signaling. Functioning as an inhibitory regulator of the Ras-cAMP pathway, SYNGAP1 is integral to synaptic function and plasticity. Within the excitatory synapses, it serves as a member of the NMDAR signaling complex, potentially influencing NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking, and overall synaptic plasticity. Furthermore, SYNGAP1 regulates AMPAR-mediated miniature excitatory postsynaptic currents and exhibits dual GTPase-activating specificity for both Ras and Rap. Interactions with KLHL17, CAMK2A, CAMK2B, and MPDZ highlight its intricate network within synaptic signaling pathways. Notably, it may be implicated in certain forms of brain injury, leading to long-term deficits in learning and memory, underscoring its critical role in neural function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q96PV0 (M1161-H1343)
-
Molecular Construction
-
N-term
-
His
-
SYNGAP1 (M1161-H1343)
Accession # Q96PV0 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SYNGAP1; Synaptic Ras GTPase Activating Protein 1 Homolog (Rat); Synaptic Ras GTPase Activating Protein 1; Synaptic Ras GTPase Activating Protein 1 Homolog; KIAA1938; Synaptic Ras GTPase Activating Protein, 135kDa; SYNGAP; Synaptic Ras GTPase-Activating P
-
AA Sequence
MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
-
Predicted Molecular Mass
25.5 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)