T-PA Protein, Mouse (HEK293, Fc)

The T-PA protein converts the inactive plasminogen to active plasmin by hydrolyzing a single Arg-Val bond. This conversion regulates plasmin-mediated proteolysis and is involved in tissue remodeling, degradation, and cell migration. T-PA also contributes to the prevention of polyspermy during oocyte activation by participating in the cortical granule reaction. T-PA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived T-PA protein, expressed by HEK293 , with N-hFc labeled tag. The total length of T-PA Protein, Mouse (HEK293, Fc) is 251 a.a., with molecular weight of 55-60 kDa.

The T-PA protein functions by converting the inactive zymogen plasminogen into active plasmin through the hydrolysis of a single Arg-Val bond. This conversion is crucial for regulating plasmin-mediated proteolysis, which is involved in tissue remodeling, degradation, cell migration, and various physiological and pathological processes. Additionally, during oocyte activation, T-PA plays a role in the cortical granule reaction within the zona reaction, contributing to the prevention of polyspermy.

Mouse

HEK293

N-hFc

P11214 (I309-Q559)

18791  [NCBI]

IKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNMKQ

55-60 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.