Tachykinin-3 Protein, Human (His)
Based on 1 Customer Validation
Tachykinin-3 protein is a member of the tachykinin family and has multiple physiological effects such as neuronal excitation, induction of behavioral responses, potent vasodilation, stimulation of secretion, and smooth muscle contraction. Its key role in central regulation significantly affects gonadal function, highlighting its central role in coordinating physiological responses and maintaining homeostasis, particularly during reproduction. Tachykinin-3 Protein, Human (His) is the recombinant human-derived Tachykinin-3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Tachykinin-3 protein is a member of the tachykinin family and has multiple physiological effects such as neuronal excitation, induction of behavioral responses, potent vasodilation, stimulation of secretion, and smooth muscle contraction. Its key role in central regulation significantly affects gonadal function, highlighting its central role in coordinating physiological responses and maintaining homeostasis, particularly during reproduction. Tachykinin-3 Protein, Human (His) is the recombinant human-derived Tachykinin-3 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The Tachykinin-3 protein, belonging to the family of active peptides known as tachykinins, demonstrates multifaceted physiological effects, including the excitation of neurons, induction of behavioral responses, potent vasodilation, secretion stimulation, and the contraction of various smooth muscles. Additionally, Tachykinin-3 emerges as a pivotal central regulator with a critical role in governing gonadal function. The intricate interplay of these diverse actions underscores the significance of Tachykinin-3 in orchestrating physiological responses and maintaining homeostasis, particularly in the regulation of reproductive processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UHF0 (Q17-E121)
-
Molecular Construction
-
N-term
-
6*His
-
Tachykinin-3 (Q17-E121)
Accession # Q9UHF0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TAC3; Tachykinin-3; Prev. NKNB; Neurokinin-B Protein; ZNEUROK1; Preprotachykinin-B; LncZBTB39-1:2; Gamma Tachykinin 3; LncZBTB39; Preprotachykinin B; NKB; Neurokinin Beta; NK3; PRO1155; Neuromedin K; HH10; Tachykinin 3; Tachykinin Precursor 3; Neurokinin
-
AA Sequence
QSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
-
Predicted Molecular Mass
13.9 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
