Tachykinin-3 Protein, Human (His)

Tachykinin-3 protein is a member of the tachykinin family and has multiple physiological effects such as neuronal excitation, induction of behavioral responses, potent vasodilation, stimulation of secretion, and smooth muscle contraction. Its key role in central regulation significantly affects gonadal function, highlighting its central role in coordinating physiological responses and maintaining homeostasis, particularly during reproduction. Tachykinin-3 Protein, Human (His) is the recombinant human-derived Tachykinin-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Tachykinin-3 Protein, Human (His) is 105 a.a., with molecular weight of ~17.0 kDa.

The Tachykinin-3 protein, belonging to the family of active peptides known as tachykinins, demonstrates multifaceted physiological effects, including the excitation of neurons, induction of behavioral responses, potent vasodilation, secretion stimulation, and the contraction of various smooth muscles. Additionally, Tachykinin-3 emerges as a pivotal central regulator with a critical role in governing gonadal function. The intricate interplay of these diverse actions underscores the significance of Tachykinin-3 in orchestrating physiological responses and maintaining homeostasis, particularly in the regulation of reproductive processes.

Human

E. coli

N-6*His

Q9UHF0 (Q17-E121)

6866  [NCBI]

QSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.