1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Tachykinin-3 Protein, Human (His)

Tachykinin-3 Protein, Human (His)

Cat. No.: HY-P71349
SDS COA Handling Instructions

Tachykinin-3 protein is a member of the tachykinin family and has multiple physiological effects such as neuronal excitation, induction of behavioral responses, potent vasodilation, stimulation of secretion, and smooth muscle contraction. Its key role in central regulation significantly affects gonadal function, highlighting its central role in coordinating physiological responses and maintaining homeostasis, particularly during reproduction. Tachykinin-3 Protein, Human (His) is the recombinant human-derived Tachykinin-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Tachykinin-3 Protein, Human (His) is 105 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tachykinin-3 protein is a member of the tachykinin family and has multiple physiological effects such as neuronal excitation, induction of behavioral responses, potent vasodilation, stimulation of secretion, and smooth muscle contraction. Its key role in central regulation significantly affects gonadal function, highlighting its central role in coordinating physiological responses and maintaining homeostasis, particularly during reproduction. Tachykinin-3 Protein, Human (His) is the recombinant human-derived Tachykinin-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Tachykinin-3 Protein, Human (His) is 105 a.a., with molecular weight of ~17.0 kDa.

Background

The Tachykinin-3 protein, belonging to the family of active peptides known as tachykinins, demonstrates multifaceted physiological effects, including the excitation of neurons, induction of behavioral responses, potent vasodilation, secretion stimulation, and the contraction of various smooth muscles. Additionally, Tachykinin-3 emerges as a pivotal central regulator with a critical role in governing gonadal function. The intricate interplay of these diverse actions underscores the significance of Tachykinin-3 in orchestrating physiological responses and maintaining homeostasis, particularly in the regulation of reproductive processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UHF0 (Q17-E121)

Gene ID
Molecular Construction
N-term
6*His
Tachykinin-3 (Q17-E121)
Accession # Q9UHF0
C-term
Synonyms
Tachykinin-3; ZNEUROK1; Neurokinin-B; NKB; Neuromedin-K; TAC3; NKNB; UNQ585/PRO1155
AA Sequence

QSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Tachykinin-3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tachykinin-3 Protein, Human (His)
Cat. No.:
HY-P71349
Quantity:
MCE Japan Authorized Agent: