TFF3 Protein, Human (P. pastoris, His)
TFF3 Protein is crucial for maintaining and repairing the intestinal mucosa, promoting epithelial cell mobility as a motogen. As a monomer, TFF3 has individual effects, while as a disulfide-linked homodimer, it enhances cellular responses for intestinal lining integrity. TFF3's multifaceted nature underscores its significance in balancing mucosal maintenance and repair in the gastrointestinal tract. TFF3 Protein, Human (P. pastoris, His) is the recombinant human-derived TFF3 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TFF3 Protein is crucial for maintaining and repairing the intestinal mucosa, promoting epithelial cell mobility as a motogen. As a monomer, TFF3 has individual effects, while as a disulfide-linked homodimer, it enhances cellular responses for intestinal lining integrity. TFF3's multifaceted nature underscores its significance in balancing mucosal maintenance and repair in the gastrointestinal tract. TFF3 Protein, Human (P. pastoris, His) is the recombinant human-derived TFF3 protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
TFF3 Protein plays a pivotal role in the maintenance and repair of the intestinal mucosa, actively participating in healing processes by promoting the mobility of epithelial cells as a motogen. Existing both as a monomer and a homodimer, the disulfide-linked homodimeric form suggests a potential collaborative enhancement of its functions. While functioning as a monomer, TFF3 likely exerts individual effects, and as a homodimer, it may synergistically contribute to the dynamic cellular responses crucial for the integrity and restoration of the intestinal lining. The multifaceted nature of TFF3 underscores its significance in orchestrating the intricate balance of mucosal maintenance and repair within the gastrointestinal tract.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
Q07654 (A29-F80)
-
Molecular Construction
-
N-term
-
6*His
-
TFF3 (A29-F80)
Accession # Q07654 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TFF3; Polypeptide P1.B; Trefoil Factor 3; TFI; ITF; Intestinal Trefoil Factor; HITF; HP1.B; Trefoil Factor 3 (Intestinal); P1B
-
AA Sequence
ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
-
Predicted Molecular Mass
7.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
