TFF3 Protein, Mouse (HEK293, His)

TFF3 Protein maintains and repairs the intestinal mucosa, promoting epithelial cell mobility as a motogen. TFF3's monomer form has functional properties, while its homodimeric form enhances cellular responses for intestinal lining integrity. TFF3's involvement in mucosal homeostasis and repair highlights its significance in gastrointestinal tract dynamics. TFF3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TFF3 Protein, Mouse (HEK293, His) is 59 a.a., with molecular weight of ~11.0 kDa.

TFF3 Protein plays a vital role in the maintenance and repair of the intestinal mucosa, actively contributing to the healing processes by promoting the mobility of epithelial cells, acting as a motogen. As a monomer, TFF3 exhibits individual functional properties, while its homodimeric form, connected by disulfide bonds, likely enhances its capabilities in facilitating cellular responses crucial for the integrity and restoration of the intestinal lining. The involvement of TFF3 in these processes underscores its significance in the dynamic mechanisms of mucosal homeostasis and repair within the gastrointestinal tract.

Mouse

HEK293

C-6*His

Q62395 (A23-F81)

21786  [NCBI]

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF

Approximately 11.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.