TFF3 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
TFF3 Protein maintains and repairs the intestinal mucosa, promoting epithelial cell mobility as a motogen.TFF3's monomer form has functional properties, while its homodimeric form enhances cellular responses for intestinal lining integrity.TFF3's involvement in mucosal homeostasis and repair highlights its significance in gastrointestinal tract dynamics.TFF3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TFF3 Protein maintains and repairs the intestinal mucosa, promoting epithelial cell mobility as a motogen.TFF3's monomer form has functional properties, while its homodimeric form enhances cellular responses for intestinal lining integrity.TFF3's involvement in mucosal homeostasis and repair highlights its significance in gastrointestinal tract dynamics.TFF3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TFF3 Protein plays a vital role in the maintenance and repair of the intestinal mucosa, actively contributing to the healing processes by promoting the mobility of epithelial cells, acting as a motogen. As a monomer, TFF3 exhibits individual functional properties, while its homodimeric form, connected by disulfide bonds, likely enhances its capabilities in facilitating cellular responses crucial for the integrity and restoration of the intestinal lining. The involvement of TFF3 in these processes underscores its significance in the dynamic mechanisms of mucosal homeostasis and repair within the gastrointestinal tract.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q62395 (A23-F81)
-
Molecular Construction
-
N-term
-
TFF3 (A23-F81)
Accession # Q62395 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TFF3; Polypeptide P1.B; Trefoil Factor 3; TFI; ITF; Intestinal Trefoil Factor; HITF; HP1.B; Trefoil Factor 3 (Intestinal); P1B
-
AA Sequence
ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
-
Predicted Molecular Mass
7.3 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
