Copy Link Print Information

TGF beta 1/TGFB1 Protein, Human (CHO)

170 Cited Publications
Customer Review

Based on 170 publication(s) in Google Scholar

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • TGF beta 1/TGFB1 Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells[1][2].

Background

TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII[3].
The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases[4].
TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer[4].

In Vitro

TGFB1 human (0.2 ng/mL) upregulates LINC00941[5].
TGF-β1 (0.2 ng/mL) significantly and maximally inhibits the growth of MLE cells[6].
TGF–β1 (5 ng/ml) results in a significant increase in the protein and mRNA levels of IL-6 in HTM cells[7].

Verified Bioactivity

1. The ED50 is <0.2 ng/mL as measured in ability to inhibit the mouse IL-4-dependent proliferation of HT-2 cells.
2. The ability to inhibit the IL-4-dependent proliferation of TF 1 human erythroleukemic cells has an ED50 value of 4-40 pg/mL.
3. Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is <0.1 ng/mL, corresponding to a specific activity is >1×107 units/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P01137 (A279-S390)

  • Gene ID
    7040  [NCBI]
  • Molecular Construction
    • N-term
    • TGFB1 (A279-S390)
      Accession # P01137
    • C-term
  • Protein Length

    Full Length of Mature TGFB1

  • Synonyms

    TGFB1; Transforming Growth Factor Beta1; Prev. TGFB; Camurati-Engelmann Disease; Prev. DPD1; Latency-Associated Peptide; TGFbeta; TGF-Beta-1; CED; TGF-Beta1; Transforming Growth Factor Beta-1 Proprotein; IBDIMDE; Prepro-Transforming Growth Factor Beta-1;

  • AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

  • Predicted Molecular Mass

    12.8 kDa

  • Molecular Weight

    Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM NaAc, 50 mM NaCl, pH 5.0.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 0.8.
3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991)10:1091-1101.

[2]. M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14(4):2352-60. [Content Brief]

[3]. Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991.

[4]. Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124(Pt 14):2501-10. [Content Brief]

[5]. Nan Wu, et al. LINC00941 promotes CRC metastasis through preventing SMAD4 protein degradation and activating the TGF-β/SMAD2/3 signaling pathway. Cell Death Differ. 2021 Jan;28(1):219-232. [Content Brief]

[6]. Hai Zhang, et al. Effects of transforming growth factor-beta 1 (TGF-beta1) on in vitro mineralization of human osteoblasts on implant materials. Biomaterials. 2003 May;24(12):2013-20. [Content Brief]

[7]. Paloma B Liton, et al. Cross-talk between TGF-beta1 and IL-6 in human trabecular meshwork cells. Mol Vis. 2009;15:326-34. Epub 2009 Feb 11. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is 0.09738 ng/mL, corresponding to a specific activity is 1.027×107 units/mg.

  • 1/16

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]

    Customer Validation
     TGF-β1 (5 ng/mL; 24 h) and Noggin (100 ng/mL; 24 h) promote the migration of Yak PASMCs.

  • 1/16

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2022 Feb 23;13(1):1017. [Abstract]

    Customer Validation
     Transwell Matrigel invasion and migration assays of MKN-45 cells subjected to TGF-β1 (0.2 ng/mL, 8 h) and TGF-β inhibitor LY 2157299 treatment.

  • 1/16

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: J Clin Invest. 2022 Mar 1;132(5):e152394. [Abstract]

    Customer Validation
     HEK293T cells and MDA-MB-231 cells were serum starved and treated with TGFβ1 (5 ng/mL, 0-15 min), and whole-cell extracts (WCEs) were collected for IP with anti-SMAD3 antibody, followed by immunoblot (IB) analysis.

  • 1/16

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232. [Abstract]

    Customer Validation
     Western blotting assays reveal the decreased expression of epithelial markers and increased expression of mesenchymal markers in LoVo-Sh-LINC00941 cells with TGF-β (0.2 ng/mL, 12 h). In contrast, disitertide treatment increased the expression of epithelial markers and decreased the expression of mesenchymal markers in HCT-116-LINC00941 cells.

  • 1/16

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232. [Abstract]

    Customer Validation
     qRT-PCR assays reveal the decreased expression of epithelial markers and increased expression of mesenchymal markers in LoVo-Sh-LINC00941 cells with TGF-β (0.2 ng/mL, 12 h).

  • 1/16

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232. [Abstract]

    Customer Validation
     Transwell assay of LoVo-Sh-LINC00941 cells, the cells were treated with TGF-β1 (0.2 ng/ml) for 12 h.

  • TGF beta 1/TGFB1 Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Human (CHO)
  • TGF beta 1/TGFB1 Protein, Human (CHO) Product Image

  • TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072. [Abstract]

    TGF-β1 (5 ng/mL; 24 h) and Noggin (100 ng/mL; 24 h) promote the migration of Yak PASMCs.

  • TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2022 Feb 23;13(1):1017. [Abstract]

    Transwell Matrigel invasion and migration assays of MKN-45 cells subjected to TGF-β1 (0.2 ng/mL, 8 h) and TGF-β inhibitor LY 2157299 treatment.

  • TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: J Clin Invest. 2022 Mar 1;132(5):e152394. [Abstract]

    HEK293T cells and MDA-MB-231 cells were serum starved and treated with TGFβ1 (5 ng/mL, 0-15 min), and whole-cell extracts (WCEs) were collected for IP with anti-SMAD3 antibody, followed by immunoblot (IB) analysis.

  • TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232. [Abstract]

    Western blotting assays reveal the decreased expression of epithelial markers and increased expression of mesenchymal markers in LoVo-Sh-LINC00941 cells with TGF-β (0.2 ng/mL, 12 h). In contrast, disitertide treatment increased the expression of epithelial markers and decreased the expression of mesenchymal markers in HCT-116-LINC00941 cells.

  • TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232. [Abstract]

    qRT-PCR assays reveal the decreased expression of epithelial markers and increased expression of mesenchymal markers in LoVo-Sh-LINC00941 cells with TGF-β (0.2 ng/mL, 12 h).

  • TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232. [Abstract]

    Transwell assay of LoVo-Sh-LINC00941 cells, the cells were treated with TGF-β1 (0.2 ng/ml) for 12 h.