1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Human (CHO)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
250 μg Angebot einholen
500 μg Auf Lager
1 mg Auf Lager
> 1 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products

150 Publications Citing Use of MCE TGF beta 1/TGFB1 Protein, Human (CHO)

Cell Migration/Invasion Assay
IP
WB
RT-PCR

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MCE. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072.

    TGF-β1 (5 ng/mL; 24 h) and Noggin (100 ng/mL; 24 h) promote the migration of Yak PASMCs.

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MCE. Usage Cited in: Nat Commun. 2022 Feb 23;13(1):1017.  [Abstract]

    Transwell Matrigel invasion and migration assays of MKN-45 cells subjected to TGF-β1 (0.2 ng/mL, 8 h) and TGF-β inhibitor LY 2157299 treatment.

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MCE. Usage Cited in: J Clin Invest. 2022 Mar 1;132(5):e152394.  [Abstract]

    HEK293T cells and MDA-MB-231 cells were serum starved and treated with TGFβ1 (5 ng/mL, 0-15 min), and whole-cell extracts (WCEs) were collected for IP with anti-SMAD3 antibody, followed by immunoblot (IB) analysis.

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MCE. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232.  [Abstract]

    Western blotting assays reveal the decreased expression of epithelial markers and increased expression of mesenchymal markers in LoVo-Sh-LINC00941 cells with TGF-β (0.2 ng/mL, 12 h). In contrast, disitertide treatment increased the expression of epithelial markers and decreased the expression of mesenchymal markers in HCT-116-LINC00941 cells.

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MCE. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232.  [Abstract]

    qRT-PCR assays reveal the decreased expression of epithelial markers and increased expression of mesenchymal markers in LoVo-Sh-LINC00941 cells with TGF-β (0.2 ng/mL, 12 h).

    TGF beta 1/TGFB1 Protein, Human (CHO) purchased from MCE. Usage Cited in: Cell Death Differ. 2021 Jan;28(1):219-232.  [Abstract]

    Transwell assay of LoVo-Sh-LINC00941 cells, the cells were treated with TGF-β1 (0.2 ng/ml) for 12 h.
    • Biologische Aktivität

    • Technical Parameters

    • Properties

    • Beschreibung

    • Verweise

    Beschreibung

    TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells[1][2].

    Background

    TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII[3].
    The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases[4].
    TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer[4].

    In Vitro

    TGFB1 human (0.2 ng/mL) upregulates LINC00941[5].
    TGF-β1 (0.2 ng/mL) significantly and maximally inhibits the growth of MLE cells[6].
    TGF–β1 (5 ng/ml) results in a significant increase in the protein and mRNA levels of IL-6 in HTM cells[7].

    Biologische Aktivität

    1. The ED50 is <0.2 ng/mL as measured in ability to inhibit the mouse IL-4-dependent proliferation of HT-2 cells.
    2. The ability to inhibit the IL-4-dependent proliferation of TF 1 human erythroleukemic cells has an ED50 value of 4-40 pg/mL.
    3. Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is <0.1 ng/mL, corresponding to a specific activity is >1×107 units/mg.

    • Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is 0.09738 ng/mL, corresponding to a specific activity is 1.027×107 units/mg.
    Species

    Human

    Source

    CHO

    Tag

    Tag Free

    Accession

    P01137 (A279-S390)

    Gene ID
    Molecular Construction
    N-term
    TGFB1 (A279-S390)
    Accession # P01137
    C-term
    Protein Length

    Full Length of Mature TGFB1

    Synonyms
    TGF-beta-1; TGFB1; TGFB; rHuTGF-β1
    AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

    Predicted Molecular Mass
    12.8 kDa
    Molekulargewicht

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

    Reinheit
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 50 mM NaAc, 50 mM NaCl, pH 5.0.
    2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 0.8.
    3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Versand

    Room temperature in continental US; may vary elsewhere.

    Dokumentation
    Verweise
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Ihre kürzlich angesehenen Produkte:

    Online-Anfrage

    Your information is safe with us. * Required Fields.

    TGF beta 1/TGFB1 Protein, Human (CHO)

     

    Requested Quantity *

    Name des Antragstellers *

     

    Anrede

    E-Mail-Addresse *

     

    Telefonnummer *

    Department

     

    Name der Organisation *

    City

    Bundesland

    Country or Region *

         

    Bemerkungen

    Massenanfrage

    Inquiry Information

    Produktname:
    TGF beta 1/TGFB1 Protein, Human (CHO)
    Art. -Nr.:
    HY-P7118
    Menge:
    MCE Japan Authorized Agent: