TGF beta 1/TGFB1 Protein, Human (CHO)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells^[1][2].

TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII^[3].
The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases^[4].
TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer^[4].

TGFB1 human (0.2 ng/mL) upregulates LINC00941^[5].
TGF-β1 (0.2 ng/mL) significantly and maximally inhibits the growth of MLE cells^[6].
TGF–β1 (5 ng/ml) results in a significant increase in the protein and mRNA levels of IL-6 in HTM cells^[7].

1. The ED₅₀ is <0.2 ng/mL as measured in ability to inhibit the mouse IL-4-dependent proliferation of HT-2 cells.
2. The ability to inhibit the IL-4-dependent proliferation of TF 1 human erythroleukemic cells has an ED₅₀ value of 4-40 pg/mL.
3. Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED₅₀ for this effect is <0.1 ng/mL, corresponding to a specific activity is >1×10⁷ units/mg.

• 
  Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED₅₀ for this effect is 0.09738 ng/mL, corresponding to a specific activity is 1.027×10⁷ units/mg.

Human

CHO

Tag Free

P01137 (A279-S390)

7040  [NCBI]

Full Length of Mature TGFB1

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 50 mM NaAc, 50 mM NaCl, pH 5.0.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 0.8.
3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991)10:1091-1101.

  [2]. M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14(4):2352-60.  [Content Brief]

  [3]. Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991.

  [4]. Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124(Pt 14):2501-10.  [Content Brief]

  [5]. Nan Wu, et al. LINC00941 promotes CRC metastasis through preventing SMAD4 protein degradation and activating the TGF-β/SMAD2/3 signaling pathway. Cell Death Differ. 2021 Jan;28(1):219-232.  [Content Brief]

  [6]. Hai Zhang, et al. Effects of transforming growth factor-beta 1 (TGF-beta1) on in vitro mineralization of human osteoblasts on implant materials. Biomaterials. 2003 May;24(12):2013-20.  [Content Brief]

  [7]. Paloma B Liton, et al. Cross-talk between TGF-beta1 and IL-6 in human trabecular meshwork cells. Mol Vis. 2009;15:326-34. Epub 2009 Feb 11.  [Content Brief]