TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His)

TGF beta-1/TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-beta-1) chain, which maintains TGF-beta-1 latency in the extracellular matrix. It interacts with "environmental molecules" (LTBP1, LRRC32/GARP, LRRC33/NRROS) and plays a crucial regulatory role in the activation of TGF-β-1. TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His) is the recombinant TGF beta 1/TGFB1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of TGF beta 1/TGFB1 Protein, Oncorhynchus mykiss (P. pastoris, His) is 112 a.a., with molecular weight of 15 kDa.

The Transforming Growth Factor Beta-1 (TGFB1) proprotein serves as a precursor for both the Latency-associated peptide (LAP) and the active Transforming Growth Factor Beta-1 (TGF-beta-1) chains, which respectively constitute the regulatory and active subunits of TGF-beta-1. It plays a crucial role in maintaining the TGF-beta-1 chain in a latent state during storage within the extracellular matrix. Through non-covalent association with TGF-beta-1, it regulates the activation of TGF-beta-1 by interacting with 'milieu molecules' such as LTBP1, LRRC32/GARP, and LRRC33/NRROS. These interactions are pivotal in controlling the activation of TGF-beta-1. Moreover, the proprotein's interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) leads to the distortion of the Latency-associated peptide chain, resulting in the subsequent release of active TGF-beta-1.

Others

P. pastoris

N-6*His

O93449 (Q271-S382)

100136774  [NCBI]

QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

15 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.