1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. TGF-beta & TβRs
  5. TGFB2 Protein, Mouse/Rat (HEK293)

TGFB2 Protein, Mouse/Rat (HEK293)

Cat. No.: HY-P7299
Handling Instructions

TGFB2 Protein, Mouse/Rat (HEK293) performs many cellular functions and has a vital role during embryonic development.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $790 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

TGFB2 Protein, Mouse/Rat (HEK293) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P27090 (A303-S414)

Gene ID

21808

Synonyms
rMuTGF-β2; TGFB2; LAP
AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS

Molecular Weight

Approximately 12.7 kDa

Biological Activity
The ED50 is <0.2 ng/mL as measured in a cell proliferation assay using mouse HT-2 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Transforming growth factor-beta 2 (TGF-β2) is a secreted protein known as a cytokine that performs many cellular functions and has a vital role during embryonic development. It is known to suppress the effects of interleukin dependent T-cell tumors[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFB2 Protein, Mouse/Rat (HEK293)
Cat. No.:
HY-P7299
Quantity:
MCE Japan Authorized Agent: