TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293) is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Rat; Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development[1][2]. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293) is produced in HEK293 cells.

Background

In mammals, three different isoforms of TGF-β are described (TGF-β1, TGF-β2 and TGF-β3; transforming growth factor beta) to regulate apoptosis, proliferation, differentiation, migration and invasion processes utilising overlapping but not redundant mechanisms. All three isoforms are expressed in the liver, but their expression is differentially distributed among liver cell types. TGF-β2 expression in different liver cell types and is also associated with developmental defects and fibrotic diseases in mice[1][2][3].
The sequence of amino acids in TGF-β2 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGF-β2 has been only slightly altered, and that both in humans and in animals, its function is similar.
TGFβ2 is a transforming growth factor beta (TGFB) family cytokine, with members of this cytokine family playing broad regulatory roles and controlling key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2), with signals propagating via the downstream regulatory SMAD proteins. This TGFβ/SMAD pathway is frequently dysregulated in human cancer. TGFβ cytokines are capable of suppressing T cell growth in response to IL‐2. The degree of TGFβ2 expression correlated with the expression of several different markers of immune cell subsets within tumours. In addition, TGF-β2 regulates embryonic development and, therefore not surprisingly, global Tgfb2 null mice exhibit a wide range of developmental defects and perinatal mortality[1][2][3].
TGF-β2 is an immune suppressor involved in the development of immune tolerance, and recombinant TGF-β2 incubation is more potent than TGF-β1 or TGF-β3 in suppressing macrophage inflammatory responses. TGF-β2 is shown to correlate with bad prognosis in intrahepatic CCAs and hepatocellular carcinoma. Mechanistically, canonical Smad signalling as well as crosstalk with Yap, Hippo, Wnt and β-catenin signalling have been demonstrated in the liver and other organs[1][2][3].

In Vitro

Recombinant human TGF-β2 (0.125 ng/mL, 1 ng/mL, 4 ng/mL) induces nonpermissive culture podocytes switch to G2/M arrest and apoptosis, selectively at advanced TGF-β concentrations and specifically in association with suppression of Cdkn2b and activation of proapoptotic p38 mitogen-activated protein kinase, in conditionally immortalized murine podocytes[4].
Recombinant TGF-β2 (0.25-2.5 ng/mL; for 72 h) shows a dose-dependent proliferation inhibition in rat epithelial cell line (IEC-6)[6].

In Vivo

Recombinant mouse TGF-β2 (12 ng/kg; for 13 days; osmotic pump) treatment reverses the detrimental metabolic effects of high fat feeding in mice, reduces fat mass and attenuates white adipose tissue inflammation[1].
Recombinant human TGF-β2 (20, 100, and 400 μg/kg; for 9 weeks) causes modest increases in systolic blood pressure and proteinuria and minimal tubular interstitial fibrosis in normal male Sprague Dawley rats[5].

Verified Bioactivity

1.Measured by its ability to inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is <0.2 ng/mL.
2.Immobilized Recombinant Mouse TGFBR2 (C-Fc) at 5 μg/ml (100 μl/well) can bind Recombinant Mouse/Rat TGF-beta 2. Biotinylated by NHS-biotin prior to testing. The ED50 of Recombinant Mouse/Rat TGF-beta 2 is 11.28 ng/mL.

Technical Parameters

  • Species Rat; Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TGFB2 (A303-S414)
      Accession # P27090
    • C-term
  • Protein Length

    Full Length of TGFB2 Chain

  • Synonyms

    TGFB2; Transforming Growth Factor, Beta 2; Transforming Growth Factor Beta 2; BSC-1 Cell Growth Inhibitor; Glioblastoma-Derived T-Cell Suppressor Factor; TGF-Beta2; Transforming Growth Factor Beta-2 Proprotein; Polyergin; Prepro-Transforming Growth Factor Beta-2; CAEND2; Cetermin; LDS4; G-TSF

  • AA Sequence

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS

  • Predicted Molecular Mass

    12.7 kDa

  • Molecular Weight

    Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00