1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β2
  6. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293)

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293) is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development[1][2]. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293) is produced in HEK293 cells.

Background

In mammals, three different isoforms of TGF-β are described (TGF-β1, TGF-β2 and TGF-β3; transforming growth factor beta) to regulate apoptosis, proliferation, differentiation, migration and invasion processes utilising overlapping but not redundant mechanisms. All three isoforms are expressed in the liver, but their expression is differentially distributed among liver cell types. TGF-β2 expression in different liver cell types and is also associated with developmental defects and fibrotic diseases in mice[1][2][3].
The sequence of amino acids in TGF-β2 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGF-β2 has been only slightly altered, and that both in humans and in animals, its function is similar.
TGFβ2 is a transforming growth factor beta (TGFB) family cytokine, with members of this cytokine family playing broad regulatory roles and controlling key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2), with signals propagating via the downstream regulatory SMAD proteins. This TGFβ/SMAD pathway is frequently dysregulated in human cancer. TGFβ cytokines are capable of suppressing T cell growth in response to IL‐2. The degree of TGFβ2 expression correlated with the expression of several different markers of immune cell subsets within tumours. In addition, TGF-β2 regulates embryonic development and, therefore not surprisingly, global Tgfb2 null mice exhibit a wide range of developmental defects and perinatal mortality[1][2][3].
TGF-β2 is an immune suppressor involved in the development of immune tolerance, and recombinant TGF-β2 incubation is more potent than TGF-β1 or TGF-β3 in suppressing macrophage inflammatory responses. TGF-β2 is shown to correlate with bad prognosis in intrahepatic CCAs and hepatocellular carcinoma. Mechanistically, canonical Smad signalling as well as crosstalk with Yap, Hippo, Wnt and β-catenin signalling have been demonstrated in the liver and other organs[1][2][3].

In Vitro

Recombinant human TGF-β2 (0.125 ng/mL, 1 ng/mL, 4 ng/mL) induces nonpermissive culture podocytes switch to G2/M arrest and apoptosis, selectively at advanced TGF-β concentrations and specifically in association with suppression of Cdkn2b and activation of proapoptotic p38 mitogen-activated protein kinase, in conditionally immortalized murine podocytes[4].
Recombinant TGF-β2 (0.25-2.5 ng/mL; for 72 h) shows a dose-dependent proliferation inhibition in rat epithelial cell line (IEC-6)[6].

In Vivo

Recombinant mouse TGF-β2 (12 ng/kg; for 13 days; osmotic pump) treatment reverses the detrimental metabolic effects of high fat feeding in mice, reduces fat mass and attenuates white adipose tissue inflammation[1].
Recombinant human TGF-β2 (20, 100, and 400 μg/kg; for 9 weeks) causes modest increases in systolic blood pressure and proteinuria and minimal tubular interstitial fibrosis in normal male Sprague Dawley rats[5].

Biological Activity

1.Measured by its ability to inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is <0.2 ng/mL.
2.Immobilized Recombinant Mouse TGFBR2 (C-Fc) at 5 μg/ml (100 μl/well) can bind Recombinant Mouse/Rat TGF-beta 2. Biotinylated by NHS-biotin prior to testing. The ED50 of Recombinant Mouse/Rat TGF-beta 2 is 11.28 ng/mL.

  • Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 0.1368 ng/mL, corresponding to a specific activity is 7.31×106 units/mg.
Species

Rat; Mouse

Source

HEK293

Tag

Tag Free

Accession

P27090 (A303-S414)

Gene ID
Molecular Construction
N-term
TGFB2 (A303-S414)
Accession # P27090
C-term
Protein Length

Full Length of Mature TGFB2

Synonyms
TGFB2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; MGC116892; Polyergin; TGF-beta2; TGF-beta-2; transforming growth factor beta-2
AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS

Predicted Molecular Mass
12.7 kDa
Molecular Weight

Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293)
Cat. No.:
HY-P70649
Quantity:
MCE Japan Authorized Agent: