1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TPO/Thrombopoietin Protein, Cynomolgus (HEK293, His)

TPO/Thrombopoietin Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P76672
Handling Instructions Technical Support

TPO/Thrombopoietin Protein is a major regulator of megakaryocyte production and platelet generation, signaling through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. Thrombopoietin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thrombopoietin protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

TPO/Thrombopoietin Protein is a major regulator of megakaryocyte production and platelet generation, signaling through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. Thrombopoietin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thrombopoietin protein, expressed by HEK293 , with C-His labeled tag.

Background

TPO/Thrombopoietin Protein is a major regulatory factor for megakaryocyte production, which signals through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. In addition, TPO/Thrombopoietin Protein can induce receptor dimerization and tyrosine phosphorylation, as well as activate signaling pathways, such as JAK/STAT, Shc/Ras/MAPK, and PI3K/Akt[1].
In adult hematopoietic processes, TPO/Thrombopoietin Protein maintains the resting state of hematopoietic stem cells (HSC). And the loss of TPO/Thrombopoietin Protein signaling is associated with bone marrow failure and thrombocytopenia[2].

Biological Activity

Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 14.13 ng/mL, corresponding to a specific activity is 7.077×104 units/mg.

  • Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 14.13 ng/mL, corresponding to a specific activity is 7.077×104 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_005546625.1(S22-G353)

Gene ID
Molecular Construction
N-term
TPO (S22-G353)
Accession # XP_005546625.1
His
C-term
Protein Length

Full Length

Synonyms
Thrombopoietin; C-mpl ligand; THPO; MGDF
AA Sequence

SPAPPACDPRVLSKLLRDSRVLHSRLSLCPEVNPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLLLVGGPTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLQKRQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHKLLNGTRGLFPGPSRRTLGAPDISPGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPSPVVQLHPLLPDPSAPTPTPTSPLLNTSHTHSQNLSQEG

Predicted Molecular Mass
35.4 kDa
분자량

Approximately 70-96 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

TPO/Thrombopoietin Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TPO/Thrombopoietin Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TPO/Thrombopoietin Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76672
수량:
MCE Japan Authorized Agent: