1. Recombinant Proteins
  2. Receptor Proteins
  3. TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His)

TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His)

Cat. No.: HY-P73607
Handling Instructions Technical Support

TIM-1/KIM-1/HAVCR Protein, Mouse (HEK293, His) belongs to a family of immunoglobulin-like domain-containing transmembrane proteins is widely accepted to be the receptor for hepatitis A virus (HAV), an unusual, hepatotropic human picornavirus. TIM1 (HAVCR1) facilitates attachment of a variety of enveloped viruses, including filoviruses, alphaviruses, and flaviviruses, that display highly conserved phosphatidylserine (PtdSer) on their surface. TIM1 undergoes tyrosine phosphorylation of its C-terminal cytoplasmic tail. TIM-1 can function as a co-stimulatory molecule for T cell activation. TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His) is the recombinant human-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

TIM-1/KIM-1/HAVCR Protein, Mouse (HEK293, His) belongs to a family of immunoglobulin-like domain-containing transmembrane proteins is widely accepted to be the receptor for hepatitis A virus (HAV), an unusual, hepatotropic human picornavirus. TIM1 (HAVCR1) facilitates attachment of a variety of enveloped viruses, including filoviruses, alphaviruses, and flaviviruses, that display highly conserved phosphatidylserine (PtdSer) on their surface. TIM1 undergoes tyrosine phosphorylation of its C-terminal cytoplasmic tail. TIM-1 can function as a co-stimulatory molecule for T cell activation[1][2][3]. TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His) is the recombinant human-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with C-His labeled tag.

Background

TIM1 belongs to a family of immunoglobulin-like domain-containing transmembrane proteins that include three members in humans (human TIM1, TIM3, and TIM4) and eight members in mice (murine TIM1 to TIM8), of which the human TIM1, TIM3, and TIM4 are direct orthologs of murine TIM1, TIM3, and TIM4, respectively. These proteins are expressed on the cell surface, with their N-terminal immunoglobulin-like (IgV) and mucin domains present in the extracellular milieu and their C-terminal sequences in the cytoplasm. An important feature of all TIM proteins is a highly conserved phosphatidylserine (PtdSer)-binding pocket in the IgV domain that recognizes PtdSer on the outer membrane leaflet of apoptotic cells, facilitating their uptake by phagocytic cells[1].
TIM-1 is a type I membrane protein with an IgV domain followed by a heavily glycoslyated mucin domain, a transmembrane domain and an intracellular cytoplasmic tail with one tyrosine phosphorylation motif. TIM-1 can function as a co-stimulatory molecule for T cell activation. Cross-linking Tim-1 with antibodies, in conjunction with TCR and CD28 stimulation, enhances the proliferation of CD4+ T cells. over-expression of Tim-1 leads to NFAT/AP-1 transcriptional activation, dependent on Y276 in the cytoplasmic tail[2].

Species

Human

Source

HEK293

Tag

C-His

Accession

AAC39862 (S21-V135)

Gene ID
Molecular Construction
N-term
TIM-1 (S21-V135)
Accession # AAC39862
His
C-term
Protein Length

Partial

Synonyms
Hepatitis A virus cellular receptor 1; HAVcr-1; KIM-1; TIM-1; CD365; HAVCR1
AA Sequence

SVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIV

Predicted Molecular Mass
15.8 kDa
분자량

Approximately 22-26 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TIM-1/KIM-1/HAVCR Protein, Human (135a.a, HEK293, His)
Cat. No.:
HY-P73607
수량:
MCE Japan Authorized Agent: