TIM-14 Protein, S.cerevisiae
The TIM-14 protein is an important component of the PAM complex and is required for the transport of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix using ATP. TIM-14 Protein, S.cerevisiae is the recombinant TIM-14 protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The TIM-14 protein is an important component of the PAM complex and is required for the transport of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix using ATP. TIM-14 Protein, S.cerevisiae is the recombinant TIM-14 protein, expressed by E. coli , with tag free.
TIM-14 stands as an indispensable constituent of the PAM complex, a pivotal assembly instrumental in the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within this intricate molecular machinery, TIM-14 assumes a critical role in stimulating the activity of mtHSP70 (SSC1). It engages in a dynamic existence, forming homodimers and heterodimers with PAM16/TIM16. While homodimerization might not hold significance in vivo, the formation of heterodimers proves to be essential for the nuanced regulation of mtHSP70 activity. As an integral part of the larger PAM complex, TIM-14 collaborates seamlessly with mtHsp70, MGE1, TIM44, PAM16, PAM17, and PAM18/TIM14, collectively contributing to the orchestration of mitochondrial protein translocation. Additionally, TIM-14 establishes direct interactions with mtHsp70, reinforcing its role in the intricate network of molecular associations involved in ensuring the efficiency and precision of mitochondrial protein translocation. Furthermore, its direct interaction with the TIM17 subunit of the TIM23 complex adds another layer of complexity to its involvement in mitochondrial protein transport processes.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q07914 (F99-K168)
-
Gene ID850694 [NCBI]
-
Molecular Construction
-
N-term
-
TIM-14 (F99-K168)
Accession # Q07914 -
C-term
-
-
Protein Length
Partial
-
Synonyms
DNAJC19; DnaJ Homolog Subfamily C Member 19; DnaJ Heat Shock Protein Family (Hsp40) Member C19; DnaJ (Hsp40) Homolog, Subfamily C, Member 19, Isoform CRA_b; Mitochondrial Import Inner Membrane Translocase Subunit TIM14; DnaJ-Like Protein Subfamily C Membe
-
AA Sequence
FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
-
Predicted Molecular Mass
7.9 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
