TIM-16 Protein, S. cerevisiae
TIM-16 protein is an important component of the PAM complex, which uses ATP to promote the transfer of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix. TIM-16 Protein, S. cerevisiae is the recombinant TIM-16 protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TIM-16 protein is an important component of the PAM complex, which uses ATP to promote the transfer of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix. TIM-16 Protein, S. cerevisiae is the recombinant TIM-16 protein, expressed by E. coli , with tag free.
TIM-16 stands as a pivotal constituent of the PAM complex, an essential assembly dedicated to the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within this intricate complex, TIM-16 plays a crucial role in orchestrating the activity of mtHSP70 (SSC1) by engaging in a pivotal interaction with PAM18/TIM14. The strategic positioning of PAM18/TIM14 by TIM-16 at the translocon appears to optimize ATPase stimulation, thereby facilitating the efficient translocation process. TIM-16 exhibits a dynamic existence, forming homodimers and heterodimers with PAM18. While homodimerization might not hold significance in vivo, heterodimerization emerges as an indispensable prerequisite for the regulatory influence on mtHSP70 activity. As an integral component of the larger PAM complex, TIM-16 collaborates harmoniously with mtHSP70, MGE1, TIM44, PAM17, and PAM18, collectively contributing to the intricate machinery orchestrating mitochondrial protein translocation. Additionally, TIM-16 engages in interactions with MDJ2, further expanding its network of molecular associations within the mitochondrial environment.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
P42949 (T54-A119)
-
Gene ID853340 [NCBI]
-
Molecular Construction
-
N-term
-
TIM-16 (T54-A119)
Accession # P42949 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PAM16; Presequence Translocated-Associated Motor Subunit PAM16; Presequence Translocase Associated Motor 16; HCG15164, Isoform CRA_a; TIMM16; Magmas-Like Protein; Mitochondria-Associated Granulocyte Macrophage CSF-Signaling Molecule; CORO7-PAM16; Magmas;
-
AA Sequence
TLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA
-
Predicted Molecular Mass
7.9 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
