TIM-16 Protein, S. cerevisiae

TIM-16 protein is an important component of the PAM complex, which uses ATP to promote the transfer of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix. TIM-16 Protein, S. cerevisiae is the recombinant TIM-16 protein, expressed by E. coli , with tag free. The total length of TIM-16 Protein, S. cerevisiae is 66 a.a., with molecular weight of ~11.0 kDa.

TIM-16 stands as a pivotal constituent of the PAM complex, an essential assembly dedicated to the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within this intricate complex, TIM-16 plays a crucial role in orchestrating the activity of mtHSP70 (SSC1) by engaging in a pivotal interaction with PAM18/TIM14. The strategic positioning of PAM18/TIM14 by TIM-16 at the translocon appears to optimize ATPase stimulation, thereby facilitating the efficient translocation process. TIM-16 exhibits a dynamic existence, forming homodimers and heterodimers with PAM18. While homodimerization might not hold significance in vivo, heterodimerization emerges as an indispensable prerequisite for the regulatory influence on mtHSP70 activity. As an integral component of the larger PAM complex, TIM-16 collaborates harmoniously with mtHSP70, MGE1, TIM44, PAM17, and PAM18, collectively contributing to the intricate machinery orchestrating mitochondrial protein translocation. Additionally, TIM-16 engages in interactions with MDJ2, further expanding its network of molecular associations within the mitochondrial environment.

Others

E. coli

Tag Free

P42949 (T54-A119)

853340  [NCBI]

TLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA

Approximately 11.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.