Tissue Factor Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Tissue Factor (TF) serves as a crucial initiator of blood coagulation through its formation of a complex with circulating factor VII or VIIa. The resulting [TF:VIIa] complex facilitates the specific limited proteolysis of factors IX or X, thereby playing a pivotal role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Notably, TF's interaction with HSPE is significant, with heparin acting as an inhibitor; this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, underscoring TF's intricate involvement in the regulation of blood clotting processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Tissue Factor (A29-E251)
      Accession # P20352
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    F3; Coagulation Factor III (Thromboplastin, Tissue Factor); Coagulation Factor III, Tissue Factor; Coagulation Factor III; TF; Thromboplastin; Tissue Factor; CD142 Antigen; CD142; TFA

  • AA Sequence

    AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

  • Predicted Molecular Mass

    26.2 kDa

  • Molecular Weight

    Approximately 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00