Tissue Factor Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Tissue factor (TF) initiates blood coagulation by forming a complex with circulating factor VII or VIIa, thus forming the [TF:VIIa] complex. This complex is capable of specific limited proteolysis of factors IX or X and plays a key role in normal hemostasis by initiating the coagulation protease cascade. Tissue Factor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tissue Factor protein, expressed by HEK293 , with C-6*His labeled tag.
Tissue Factor (TF) serves as a crucial initiator of blood coagulation through its formation of a complex with circulating factor VII or VIIa. The resulting [TF:VIIa] complex facilitates the specific limited proteolysis of factors IX or X, thereby playing a pivotal role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Notably, TF's interaction with HSPE is significant, with heparin acting as an inhibitor; this interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, underscoring TF's intricate involvement in the regulation of blood clotting processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P20352 (A29-E251)
-
Molecular Construction
-
N-term
-
Tissue Factor (A29-E251)
Accession # P20352 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
F3; Coagulation Factor III (Thromboplastin, Tissue Factor); Coagulation Factor III, Tissue Factor; Coagulation Factor III; TF; Thromboplastin; Tissue Factor; CD142 Antigen; CD142; TFA
-
AA Sequence
AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE
-
Predicted Molecular Mass
26.2 kDa
-
Molecular Weight
Approximately 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
