TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, Fc)

TM4SF2/TSPAN7 protein is an important member of the tetraspanin family and plays an important role in signal transduction, cell adhesion, and membrane organization. Its research enhances understanding of cell membrane dynamics and provides potential applications in cell biology and cancer research. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-mFc labeled tag.

The TM4SF2/TSPAN7 Protein is a pivotal member of the tetraspanin (TM4SF) family, highlighting its essential role in various cellular processes, including signal transduction, cell adhesion, and membrane organization. As part of this family, TM4SF2/TSPAN7 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane dynamics. The study of TM4SF2/TSPAN7 contributes to our understanding of its role in diverse physiological processes, offering potential applications in cell biology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of TM4SF2/TSPAN7's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Cynomolgus

HEK293

N-mFc

Q4R5A3 (R113-M213)

102127880  [NCBI]

Partial

RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLDHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Approximately 45-49 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.