Copy Link Print Information

TM4SF2/TSPAN7 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Background

TM4SF2/TSPAN7 protein is potentially involved in both cell proliferation and cell motility. It may play a role in regulating these processes, although the exact mechanisms are still unclear. Its involvement in cell proliferation suggests that it may be important for cellular growth and division, while its role in cell motility indicates its potential contribution to movement and migration of cells. Further research is needed to fully understand the specific functions and regulatory pathways in which TM4SF2/TSPAN7 protein participates.

Verified Bioactivity

When Recombinant Mouse TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody, The ED50 for this effect is 64.8 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q62283 (R113-M213)

  • Gene ID
    21912  [NCBI]
  • Molecular Construction
    • N-term
    • TM4SF2 (R113-M213)
      Accession # Q62283
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    Mxs1; Tm4sf2; Tetraspanin-7; Tspan-7; Cell surface glycoprotein A15; PE31; TALLA homolog; Transmembrane 4 superfamily member 2; CD antigen; CD231; XLID58; CCG-B7; TM4SF2b; Tetraspanin; Tetraspanin Protein; Transmembrane 4 Superfamily 2b; Transmembrane Pro

  • AA Sequence

    RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

  • Predicted Molecular Mass

    11.5 kDa

  • Molecular Weight

    Approximately 19-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) Product Image
    1/16
  • TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) Product Image