TM4SF2/TSPAN7 Protein, Mouse (HEK293, His)

The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

TM4SF2/TSPAN7 protein is potentially involved in both cell proliferation and cell motility. It may play a role in regulating these processes, although the exact mechanisms are still unclear. Its involvement in cell proliferation suggests that it may be important for cellular growth and division, while its role in cell motility indicates its potential contribution to movement and migration of cells. Further research is needed to fully understand the specific functions and regulatory pathways in which TM4SF2/TSPAN7 protein participates.

When Recombinant Mouse TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody, The ED₅₀ for this effect is 64.8 ng/mL.

Mouse

HEK293

C-His

Q62283 (R113-M213)

21912  [NCBI]

Partial

RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Approximately 19-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.