TMEM119 Protein, Human (P. pastoris, His)

The TMEM119 protein is critical in bone formation and helps myoblasts differentiate into osteoblasts. It induces commitment and differentiation by enhancing BMP2 production and interacting with the BMP-RUNX2 pathway. TMEM119 Protein, Human (P. pastoris, His) is the recombinant human-derived TMEM119 protein, expressed by P. pastoris, with N-6*His labeled tag.

The TMEM119 protein plays a crucial role in bone formation and the normal mineralization of bones, actively participating in the differentiation of myoblasts into osteoblasts. It is suggested to induce the commitment and differentiation of myoblasts into osteoblasts through the enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. TMEM119 also contributes to osteoblast differentiation by up-regulating the expression of ATF4, a central transcription factor in this process. Beyond its role in bone development, TMEM119 is deemed essential for normal spermatogenesis and late testicular differentiation. Molecularly, TMEM119 interacts with key regulators of osteogenesis, including SMAD1, SMAD5, and RUNX2, underlining its intricate involvement in bone formation and spermatogenesis processes, highlighting its significance in multiple facets of physiological development.

Human

P. pastoris

N-6*His

Q4V9L6 (R26-M96)

338773

Extracellular Domain

RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

Approximately 15-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/mv4-11-cell.html  [Content Brief]