TNF RII/TNFRSF1B Protein, Human (Biotinylated, HEK293, His)

The TNFRII protein is a receptor with high affinity for TNFSF2/TNF-α and low affinity for TNFSF1/lymphotoxin-α, and plays a key role in mediating the metabolic effects of TNF-α. The TRAF1/TRAF2 complex recruits BIRC2 and BIRC3 to TNFRSF1B/TNFR2 to regulate the apoptotic pathway. TNF RII/TNFRSF1B Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TNF RII/TNFRSF1B protein, expressed by HEK293 , with C-His labeled tag.

The TNFRII protein serves as a receptor with a high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2, thereby modulating apoptotic pathways. This receptor plays a pivotal role in mediating the majority of the metabolic effects induced by TNF-alpha. Notably, its isoform 2 exhibits the ability to block TNF-alpha-induced apoptosis, suggesting a regulatory role in antagonizing the biological activity of TNF-alpha. Furthermore, TNFRII binds to TRAF2, highlighting its involvement in downstream signaling cascades. Additionally, interactions with BMX and the activated form of XPNPEP3 further contribute to the complexity of its molecular associations.

Human

HEK293

C-8*His

P20333-1 (L23-D257)

7133  [NCBI]

Extracellular Domain

Biotin

The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.