1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. TACI Protein
  6. TNFRSF13B Protein, Human (HEK293, Fc)

TNFRSF13B Protein, Human (HEK293, Fc)

Cat. No.: HY-P72458
COA Handling Instructions

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human (HEK293, Fc) is the recombinant human-derived TNFRSF13B protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TNFRSF13B Protein, Human (HEK293, Fc) is 165 a.a., with molecular weight of 50-54 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $87 In-stock
50 μg $260 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human (HEK293, Fc) is the recombinant human-derived TNFRSF13B protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TNFRSF13B Protein, Human (HEK293, Fc) is 165 a.a., with molecular weight of 50-54 kDa.

Background

TNFRSF13B Protein serves as the receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS, demonstrating high-affinity binding to both ligands. Its activation results in calcineurin-dependent activation of NF-AT, along with the activation of NF-kappa-B and AP-1, thereby playing a crucial role in stimulating B- and T-cell function and regulating humoral immunity. Additionally, TNFRSF13B binds TRAF2, TRAF5, and TRAF6, suggesting its involvement in various signaling pathways. Notably, it interacts with the NH2-terminal domain of CAMLG using its C-terminus.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O14836 (S2­T166)

Gene ID
Molecular Construction
N-term
TNFRSF13B (S2­T166)
Accession # O14836
hFc
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 13B; TACI; CD267; Tnfrsf13b
AA Sequence

SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST

Molecular Weight

50-54 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TNFRSF13B Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF13B Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72458
Quantity:
MCE Japan Authorized Agent: