1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Lymphotoxin β Receptor
  6. TNFRSF3/LTBR Protein, Rat (HEK293, Fc)

TNFRSF3/LTBR Protein, Rat (HEK293,  Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Rat (HEK293,  Fc) is expressed by HEK293 cells with a His tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNFRSF3/LTBR Protein, Rat (HEK293,  Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Rat (HEK293,  Fc) is expressed by HEK293 cells with a His tag at the C-terminus[1].

Background

Lymphotoxin beta receptor (LTBR), also known as tumor necrosis factor receptor superfamily member 3 (TNFRSF3), is a member of the tumor necrosis factor receptor superfamily and a cell surface receptor for lymphotoxins involved in apoptosis and cytokine release. LTBR is expressed on the surface of most cell types, including breast, colorectal, lung, gastric, melanoma, and bladder cancers , while its ligands lymphotoxin (LT) a1b2 and TNF superfamily member 14 (TNFSF14; also known as LIGHT), are mainly expressed on the surface of immune cells. The LTBR signaling pathway may be involved in the activation of responses that control cell differentiation, growth and death, as manifested by the formation of peripheral lymphoid-like organs, especially secondary and tertiary lymphoid structures critical for tissue, dendritic cell homeostasis, liver regeneration, interferon response to pathogens and death in mucosa-derived carcinomas. LTβR signaling may facilitate communication between infiltrating immune cells and tumor cells. Triggering LTβR induces typical and atypical nuclear factor (NF)-κB signaling pathways that are associated with inflammation-induced oncogenic effects. Sustained LTβR signaling also leads to NF-κB-mediated chronic inflammation and the development of hepatocellular carcinoma (HCC)[1][2].

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q5U2S8 (S28-A218)

Gene ID
Molecular Construction
N-term
LTBR (S28-A218)
Accession # Q5U2S8
hFc
C-term
Protein Length

Partial

Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 3; TNF-RIII; TNFCR; TNFR3
AA Sequence

SQPQLVPPYRIENQTCWDPDKEYYEPLHQVCCSRCPPGKFVHAVCSPSQDTVCKTCLHNSYNEHWNHLFSCQLCRPCDSVLGFEEIAPCTSDRKPECRCKPGMSCVYLDNECVHCEEERLVLCRPGTEAEVTDEIMDTEVNCVPCKPGHFQNTSSPRARCQPHTRCESQGLVEAASGTSYSDTICKNPPEA

Predicted Molecular Mass
48.5 kDa
Molecular Weight

Approximately 66 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TNFRSF3/LTBR Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF3/LTBR Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75917
Quantity:
MCE Japan Authorized Agent: