TNFRSF3/LTBR Protein, Rat (HEK293, Fc)

TNFRSF3/LTBR Protein, Rat (HEK293,  Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Rat (HEK293,  Fc) is expressed by HEK293 cells with a His tag at the C-terminus^[1].

Lymphotoxin beta receptor (LTBR), also known as tumor necrosis factor receptor superfamily member 3 (TNFRSF3), is a member of the tumor necrosis factor receptor superfamily and a cell surface receptor for lymphotoxins involved in apoptosis and cytokine release. LTBR is expressed on the surface of most cell types, including breast, colorectal, lung, gastric, melanoma, and bladder cancers , while its ligands lymphotoxin (LT) a1b2 and TNF superfamily member 14 (TNFSF14; also known as LIGHT), are mainly expressed on the surface of immune cells. The LTBR signaling pathway may be involved in the activation of responses that control cell differentiation, growth and death, as manifested by the formation of peripheral lymphoid-like organs, especially secondary and tertiary lymphoid structures critical for tissue, dendritic cell homeostasis, liver regeneration, interferon response to pathogens and death in mucosa-derived carcinomas. LTβR signaling may facilitate communication between infiltrating immune cells and tumor cells. Triggering LTβR induces typical and atypical nuclear factor (NF)-κB signaling pathways that are associated with inflammation-induced oncogenic effects. Sustained LTβR signaling also leads to NF-κB-mediated chronic inflammation and the development of hepatocellular carcinoma (HCC)^[1][2].

Rat

HEK293

C-hFc

Q5U2S8 (S28-A218)

297604  [NCBI]

Partial

SQPQLVPPYRIENQTCWDPDKEYYEPLHQVCCSRCPPGKFVHAVCSPSQDTVCKTCLHNSYNEHWNHLFSCQLCRPCDSVLGFEEIAPCTSDRKPECRCKPGMSCVYLDNECVHCEEERLVLCRPGTEAEVTDEIMDTEVNCVPCKPGHFQNTSSPRARCQPHTRCESQGLVEAASGTSYSDTICKNPPEA

Approximately 66 kDa,based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.  [Content Brief]

  [2]. Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16(1):937-942.  [Content Brief]