Copy Link Print Information

TRAIL R2/TNFRSF10B Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TRAIL R2/TNFRSF10B Protein, Human (HEK293)
  • TRAIL R2/TNFRSF10B Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Background

TNFRSF10B can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces apoptosis signal. TNFRSF10B inhibits tumor formation through apoptosis but deregulation encourages metastasis, migration and invasion of tumor cell tissues[1].

Verified Bioactivity

1. The ED50 is <6 ng/mL as measured by RPMI-8226 cells, corresponding to a specific activity of >1.0 × 106 units/mg.
2. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells treated with TRAIL. The ED50 for this effect is 43.96 ng/mL, corresponding to a specific activity is 2.275×104 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells treated with TRAIL. The ED50 for this effect is 43.96 ng/mL, corresponding to a specific activity is 2.275×104 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    O14763 (A54-E182)

  • Gene ID
    8795  [NCBI]
  • Molecular Construction
    • N-term
    • TRAIL-R2 (A54-E182)
      Accession # O14763
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    TNFRSF10B; ZTNFR9; TNF Receptor Superfamily Member 10b; CDNA FLJ76289, Highly Similar To Homo Sapiens Tumor Necrosis Factor Receptor Superfamily, Member 10b (TNFRSF10B), Transcript Variant 1, MRNA; TRAIL-R2; P53-Regulated DNA Damage-Inducible Cell Death R

  • AA Sequence

    ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

  • Predicted Molecular Mass

    14.5 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B): an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells treated with TRAIL. The ED50 for this effect is 43.96 ng/mL, corresponding to a specific activity is 2.275×104 units/mg.

  • TRAIL R2/TNFRSF10B Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for TRAIL R2/TNFRSF10B Protein, Human (HEK293)
  • TRAIL R2/TNFRSF10B Protein, Human (HEK293) Product Image