TRAIL R2/TNFRSF10B Protein, Human
Based on 1 Customer Validation
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and recruits caspase-8 through FADD to initiate cell apoptosis. It forms the death-inducing signaling complex (DISC), activates caspases and mediates apoptosis. TRAIL R2/TNFRSF10B Protein, Human is the recombinant human-derived TRAIL R2/TNFRSF10B protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and recruits caspase-8 through FADD to initiate cell apoptosis. It forms the death-inducing signaling complex (DISC), activates caspases and mediates apoptosis. TRAIL R2/TNFRSF10B Protein, Human is the recombinant human-derived TRAIL R2/TNFRSF10B protein, expressed by E. coli , with tag free.
Background
The TRAIL R2/TNFRSF10B Protein functions as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon ligand binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, forming the death-inducing signaling complex (DISC), which triggers caspase-8 proteolytic activation and initiates the subsequent cascade of caspases, mediating apoptosis. Additionally, TRAIL R2/TNFRSF10B promotes the activation of NF-kappa-B and is essential for endoplasmic reticulum (ER) stress-induced apoptosis. In its monomeric state, it can interact with TRADD and RIPK1, and in the absence of stimulation, it interacts with BIRC2, DDX3X, and GSK3B. Stimulation of the receptor enhances interactions with BIRC2 and DDX3X, accompanied by their cleavage. Notably, TRAIL R2/TNFRSF10B can also interact with the HCMV protein UL141, preventing cell surface expression, where two TNFRSF10B monomers interact with a UL141 homodimer, and three TNFRSF10B molecules interact with TNFSF10 homotrimer. These intricate interactions underline the multifaceted role of TRAIL R2/TNFRSF10B in apoptotic and signaling pathways.
Verified Bioactivity
Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 5.9 ng/mL, corresponding to a specific activity is 1.69×105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O14763 (E52-S183)
-
Molecular Construction
-
N-term
-
TRAIL-R2 (E52-S183)
Accession # O14763 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFRSF10B; ZTNFR9; TNF Receptor Superfamily Member 10b; CDNA FLJ76289, Highly Similar To Homo Sapiens Tumor Necrosis Factor Receptor Superfamily, Member 10b (TNFRSF10B), Transcript Variant 1, MRNA; TRAIL-R2; P53-Regulated DNA Damage-Inducible Cell Death Receptor(Killer); TRAILR2; Tumor Necrosis Factor Receptor-Like Protein ZTNFR9; KILLER; Death Domain Containing Receptor For TRAIL/Apo-2L; DR5; Apoptosis Inducing Protein TRICK2A/2B; Tumor Necrosis Factor Receptor Superfamily, Member 10b; Apoptosis Inducing Receptor TRAIL-R2; Tumor Necrosis Factor Receptor Superfamily Member 10B; Cytotoxic TRAIL Receptor-2; TRICK2A; TNFRSF10B Protein; TRICKB; Fas-Like Protein; CD262; TRAIL Receptor 2; TNF-Related Apoptosis-Inducing Ligand Receptor 2; CD262 Antigen; Death Receptor 5; KILLER/DR5; TRICK2; TRICK2B
-
AA Sequence
ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES
-
Predicted Molecular Mass
14.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)