1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Decoy Receptor 2
  6. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc)

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P76864
Handling Instructions Technical Support

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TRAILR4/TNFRSF10D functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4 not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling[1][2][3].

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

XP_001107922.1 (A56-L206)

Gene ID
Molecular Construction
N-term
TRAIL (A56-L206)
Accession # XP_001107922.1
hFc
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 10D; DcR2; TRAIL-R4; CD264; TRUNDD
AA Sequence

ATISRKDEVPLPPVASKQQRRSLEAECPAGFHRSEHTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNTSSCTTTRDTVCQCEKGSFQDANSPEMCRKCSTGCPRGMIKVSDCTPWSDINCSASAASSTGKTPAAEDTVPTSLGTPDL

Predicted Molecular Mass
42.9 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P76864
Quantity:
MCE Japan Authorized Agent: