TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc)

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-hFc labeled tag.

TRAILR4/TNFRSF10D functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4 not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling^[1][2][3].

Rhesus Macaque

HEK293

C-hFc

XP_001107922.1 (A56-L206)

716901  [NCBI]

Partial

ATISRKDEVPLPPVASKQQRRSLEAECPAGFHRSEHTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNTSSCTTTRDTVCQCEKGSFQDANSPEMCRKCSTGCPRGMIKVSDCTPWSDINCSASAASSTGKTPAAEDTVPTSLGTPDL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.