1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Decoy Receptor 2
  6. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76865
Handling Instructions Technical Support

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

Background

TRAILR4/TNFRSF10D functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4 not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling[1][2][3].

Biological Activity

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.265 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 1.60 ×105 units/mg.

  • Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.265 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 1.60 ×105 units/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

XP_001107922 (A56-L206)

Gene ID
Molecular Construction
N-term
TRAIL (A56-L206)
Accession # XP_001107922
His
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 10D; DcR2; TRAIL-R4; CD264; TRUNDD
AA Sequence

ATISRKDEVPLPPVASKQQRRSLEAECPAGFHRSEHTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNTSSCTTTRDTVCQCEKGSFQDANSPEMCRKCSTGCPRGMIKVSDCTPWSDINCSASAASSTGKTPAAEDTVPTSLGTPDL

Predicted Molecular Mass
15.9 kDa
분자량

Approximately 23-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76865
수량:
MCE Japan Authorized Agent: