1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Decoy Receptor 2
  6. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76865
Handling Instructions Technical Support

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TRAILR4/TNFRSF10D Protein , a receptor for TRAIL. Paradoxically, it not only fails to induce apoptosis but also protects against TRAIL-mediated apoptosis. Conflicting reports exist about its role in activating the NF-kappa-B pathway. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and a protective factor, highlights the complexity of its regulatory functions in cellular responses to TRAIL signaling. TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

Background

TRAILR4/TNFRSF10D functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4 not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4 in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling[1][2][3].

Biological Activity

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.265 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 1.60 ×105 units/mg.

  • Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.265 ng/mL in the presence of 20 ng/mL of rhTRAIL, corresponding to a specific activity is 1.60 ×105 units/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

XP_001107922 (A56-L206)

Gene ID
Molecular Construction
N-term
TRAIL (A56-L206)
Accession # XP_001107922
His
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 10D; DcR2; TRAIL-R4; CD264; TRUNDD
AA Sequence

ATISRKDEVPLPPVASKQQRRSLEAECPAGFHRSEHTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNTSSCTTTRDTVCQCEKGSFQDANSPEMCRKCSTGCPRGMIKVSDCTPWSDINCSASAASSTGKTPAAEDTVPTSLGTPDL

Predicted Molecular Mass
15.9 kDa
Molecular Weight

Approximately 23-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAILR4/TNFRSF10D Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76865
Quantity:
MCE Japan Authorized Agent: