TREML1 Protein, Human (HEK293, hFc)

TREML1 is a trigger receptor 1 expressed on myeloid cells that activates myeloid cells via the adaptor protein DAP12. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD. TREML1 Protein, Human (HEK293, hFc) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-hFc labeled tag.

TREML1 is a trigger receptor 1 expressed on myeloid cells, and monocytes/macrophages and blood neutrophils are the main effector cells in the innate response to human TREML1. TREML1 activates myeloid cells through the adaptor protein DAP12. TREMs family not only participate in the regulation of microglial phagocytosis and amyloid clearance but also play an indispensable role in the neuroinflammatory response of AD. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD^[1][2][3].

Human

HEK293

C-hFc

Q86YW5/XP_016866312.1 (Q16-P162)

340205  [NCBI]

Extracellular Domain

QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.