TrpA Protein, E.coli
Based on 1 Customer Validation
The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.
The TrpA protein, with its alpha subunit, takes on the crucial role of catalyzing the aldol cleavage of indoleglycerol phosphate, yielding indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the functional significance of TrpA in the tryptophan biosynthesis pathway, contributing to the generation of essential components for cellular processes. The alpha subunit's specific involvement in this cleavage reaction underscores its role as a key catalyst in the intricate biochemical machinery governing the synthesis of tryptophan in various biological contexts.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag Tag Free
-
Accession
P0A877 (M1-S268)
-
Gene ID58388661 [NCBI]
-
Molecular Construction
-
N-term
-
TrpA (M1-S268)
Accession # P0A877 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Tryptophan synthase alpha chain; trpA;
-
AA Sequence
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS
-
Predicted Molecular Mass
28.7 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
