Copy Link Print Information

TSC22/TSC22D1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TSC22/TSC22D1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.

Background

TSC22D1, a protein integral to the regulation of cellular processes, acts as a positive modulator of cell death in response to TGFB3 during mammary gland involution. Notably, it forms a heterodimer with TSC22D4/THG1, indicating its involvement in complex interactions that contribute to cellular functions. Additionally, TSC22D1 exhibits interactions with histone H1-2 and GNL3, underlining its versatile role in molecular processes and highlighting its potential significance in various cellular contexts.

Verified Bioactivity

Measured by its ability to inhibit the cell growth of Hela cells. The ED50 for this effect is 0.6712 μg/mL, corresponding to a specific activity is 1.489×103 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession

    Q15714-2 (M1-A144)

  • Gene ID
    8848  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • TSC22 (M1-A144)
      Accession # Q15714-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    TSC22D1; KIAA1994; TGFB1I4; TSC22; hucep-2; TSC22 domain family protein 1; Cerebral protein 2; HUCEP-2; Regulatory protein TSC-22; TGFB-stimulated clone 22 homolog; Transforming growth factor beta-1-induced transcript 4 protein; Ptg-2; TGFbeta-Stimulated

  • AA Sequence

    MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

  • Predicted Molecular Mass

    15.7 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TSC22/TSC22D1 Protein, Human (His) Product Image
    1/16
  • TSC22/TSC22D1 Protein, Human (His) Product Image