1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78789
Handling Instructions Technical Support

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 131 a.a., with molecular weight of ~12 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 131 a.a., with molecular weight of ~12 kDa.

Background

The TSLP (thymic stromal lymphopoietin) protein is a cytokine with diverse immunomodulatory functions. It induces the release of T-cell-attracting chemokines from monocytes and promotes the maturation of CD11c(+) dendritic cells, playing a crucial role in the regulation of immune responses. TSLP is known to have implications in allergic inflammation by directly activating mast cells, contributing to the complex network of allergic responses. TSLP exerts its effects by interacting with a receptor complex composed of CRLF2 and IL7R, and the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for recruiting IL7R to form the high-affinity ternary complex. These interactions highlight the intricate molecular mechanisms through which TSLP influences immune cell behavior, emphasizing its role in immune system regulation and allergic responses.

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-His

Accession

A0A7N9CAT7 (Y29-Q159)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
Thymic stromal lymphopoietin; Thymic stroma-derived lymphopoietin; TSLP
AA Sequence

YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Predicted Molecular Mass
18.8 kDa
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Documentation

TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78789
Quantity:
MCE Japan Authorized Agent: