TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of TSLP Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 131 a.a., with molecular weight of ~12 kDa.

The TSLP (thymic stromal lymphopoietin) protein is a cytokine with diverse immunomodulatory functions. It induces the release of T-cell-attracting chemokines from monocytes and promotes the maturation of CD11c(+) dendritic cells, playing a crucial role in the regulation of immune responses. TSLP is known to have implications in allergic inflammation by directly activating mast cells, contributing to the complex network of allergic responses. TSLP exerts its effects by interacting with a receptor complex composed of CRLF2 and IL7R, and the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for recruiting IL7R to form the high-affinity ternary complex. These interactions highlight the intricate molecular mechanisms through which TSLP influences immune cell behavior, emphasizing its role in immune system regulation and allergic responses.

Cynomolgus

HEK293

C-Avi;C-His

A0A7N9CAT7 (Y29-Q159)

102119254  [NCBI]

Full Length of Mature Protein

Biotin

YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.