TUBB4A Protein, Human (His)
TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag.
The TUBB4A protein takes center stage as the primary component of microtubules, contributing to the formation of cylindrical structures through the lateral association of linear protofilaments composed of alpha- and beta-tubulin heterodimers. The dynamic growth of microtubules is facilitated by the addition of GTP-tubulin dimers to the microtubule end, resulting in the formation of a stabilizing cap. Below this cap, TUBB4A protein dimers transition to a GDP-bound state, a process regulated by the GTPase activity of alpha-tubulin. This intricate mechanism underscores the crucial role of TUBB4A in governing the assembly and stability of microtubules.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P04350 (M1-A444)
-
Molecular Construction
-
N-term
-
6*His
-
TUBB4A (M1-A444)
Accession # P04350 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TUBB4A; TUBB4; TUBB5; Tubulin beta-4A chain; Tubulin 5 beta; Tubulin beta-4 chain; Tubulin, Beta, 5; Class IVa Beta-Tubulin; Dystonia 4, Torsion (Autosomal Dominant); Beta-5; DYT4; Tubulin, Beta 4 Class Iva; Tubulin Beta 4A Class Iva; Tubulin, Beta 4
-
AA Sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
-
Predicted Molecular Mass
51.7 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
