TXNDC4 Protein, Human (HEK293, His)
The TXNDC4 protein is critical in cellular processes, mediating thiol-dependent retention in the early secretory pathway.Its conserved CRFS motif forms mixed disulfide bonds with substrate proteins to control oxidative protein folding in the endoplasmic reticulum and maintain cellular redox balance.TXNDC4 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TXNDC4 protein is critical in cellular processes, mediating thiol-dependent retention in the early secretory pathway.Its conserved CRFS motif forms mixed disulfide bonds with substrate proteins to control oxidative protein folding in the endoplasmic reticulum and maintain cellular redox balance.TXNDC4 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TXNDC4 Protein plays a pivotal role in cellular processes by mediating thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. This interaction is integral to the control of oxidative protein folding in the endoplasmic reticulum, highlighting TXNDC4's involvement in maintaining cellular redox balance. Notably, the protein inhibits the calcium channel activity of ITPR1 and is required for the retention of ERO1A and ERO1B in the endoplasmic reticulum. TXNDC4 forms mixed disulfides with both ERO1A and ERO1B, as well as cargo folding intermediates, contributing to their retention in the endoplasmic reticulum. Furthermore, the direct interaction with ITPR1 occurs in a pH-, redox state-, and calcium-dependent manner, with the strength of this interaction inversely correlating with calcium concentration. The multifaceted role of TXNDC4 underscores its significance in cellular homeostasis, particularly in regulating protein folding and redox dynamics within the secretory pathway.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9BS26 (E30-D402)
-
Molecular Construction
-
N-term
-
TXNDC4 (E30-D402)
Accession # Q9BS26 -
6*His
-
C-term
-
-
Protein Length
Full Length of Endoplasmic reticulum resident protein 44 Chain
-
Synonyms
ERP44; Thioredoxin Domain Containing 4 (Endoplasmic Reticulum); Prev. TXNDC4; ER Protein 44; Endoplasmic Reticulum Resident Protein 44; Endoplasmic Reticulum Resident Protein 44 KDa; Thioredoxin Domain-Containing Protein 4; Epididymis Secretory Sperm Bind
-
AA Sequence
EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRD
-
Predicted Molecular Mass
44.2 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
