TXNDC4 Protein, Human (HEK293, His)

The TXNDC4 protein is critical in cellular processes, mediating thiol-dependent retention in the early secretory pathway. Its conserved CRFS motif forms mixed disulfide bonds with substrate proteins to control oxidative protein folding in the endoplasmic reticulum and maintain cellular redox balance. TXNDC4 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TXNDC4 Protein, Human (HEK293, His) is 373 a.a., with molecular weight of ~50.0 kDa.

TXNDC4 Protein plays a pivotal role in cellular processes by mediating thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. This interaction is integral to the control of oxidative protein folding in the endoplasmic reticulum, highlighting TXNDC4's involvement in maintaining cellular redox balance. Notably, the protein inhibits the calcium channel activity of ITPR1 and is required for the retention of ERO1A and ERO1B in the endoplasmic reticulum. TXNDC4 forms mixed disulfides with both ERO1A and ERO1B, as well as cargo folding intermediates, contributing to their retention in the endoplasmic reticulum. Furthermore, the direct interaction with ITPR1 occurs in a pH-, redox state-, and calcium-dependent manner, with the strength of this interaction inversely correlating with calcium concentration. The multifaceted role of TXNDC4 underscores its significance in cellular homeostasis, particularly in regulating protein folding and redox dynamics within the secretory pathway.

Human

HEK293

C-6*His

Q9BS26 (E30-D402)

23071  [NCBI]

EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRD

Approximately 50.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.