1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. UFC1 Protein, Human (sf9, His, StreII)

The UFC1 protein catalyzes the second step of ufmylation, accepting UFM1 from UBA5 and forming an intermediate with UFM1. Ufmylation is involved in reticulophagy and interacts with UBA5, UFL1, and UFM1. It also interacts with KIRREL3. UFC1 Protein, Human (sf9, His, Strep) is the recombinant human-derived UFC1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UFC1 protein catalyzes the second step of ufmylation, accepting UFM1 from UBA5 and forming an intermediate with UFM1. Ufmylation is involved in reticulophagy and interacts with UBA5, UFL1, and UFM1. It also interacts with KIRREL3. UFC1 Protein, Human (sf9, His, Strep) is the recombinant human-derived UFC1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UFC1, functioning as an E1-like enzyme, plays a crucial role in the second step of ufmylation, a specific post-translational modification process. This enzyme accepts UFM1 from the E1 enzyme UBA5, forming an intermediate with UFM1 through a thioester linkage. Notably, ufmylation is implicated in reticulophagy (ER-phagy) triggered by endoplasmic reticulum stress. UFC1 engages in interactions with key partners, including UBA5, highlighting its intricate involvement in the ufmylation pathway. Furthermore, UFC1 interacts with UFL1 and KIRREL3, underscoring its potential role in diverse cellular processes beyond ufmylation. These interactions emphasize the significance of UFC1 in orchestrating cellular responses to stress and maintaining cellular homeostasis.

Species

Human

Source

Sf9 insect cells

Tag

N-StrepⅡ;N-8*His

Accession

Q9Y3C8 (A2-Q167)

Gene ID

51506

Molecular Construction
N-term
8*His-StrepⅡ
UFC1 (A2-Q167)
Accession # Q9Y3C8
C-term
Protein Length

Partial

Synonyms
UFC1; Ubiquitin-fold modifier-conjugating enzyme 1; Ufm1-conjugating enzyme 1
AA Sequence

ADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ

Predicted Molecular Mass
22.5 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UFC1 Protein, Human (sf9, His, StreII) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UFC1 Protein, Human (sf9, His, StreII)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UFC1 Protein, Human (sf9, His, StreII)
Cat. No.:
HY-P701492
Quantity:
MCE Japan Authorized Agent: