ULBP-6/RAET1L Protein, Human (HEK293, Fc)

ULBP-6/RAET1L Protein, a key immune response modulator, activates the KLRK1/NKG2D receptor, triggering natural killer (NK) cell cytotoxicity. This engagement is pivotal for the immune system's defense against threats, showcasing ULBP-6/RAET1L's orchestration of NK cell responses. Its specificity is highlighted by the absence of a binding association with beta2-microglobulin in molecular interactions. ULBP-6/RAET1L Protein, Human (HEK293, Fc) is the recombinant human-derived ULBP-6/RAET1L protein, expressed by HEK293 , with C-hFc labeled tag.

NKG2DL2, a key participant in immune response modulation, exerts its influence by binding to and activating the KLRK1/NKG2D receptor. This interaction serves as a pivotal trigger for natural killer (NK) cell cytotoxicity, a fundamental aspect of the immune system's defense against various threats. NKG2DL2's ability to engage with KLRK1/NKG2D underscores its role in orchestrating NK cell responses. Notably, it does not form a binding association with beta2-microglobulin, further elucidating the specificity of its molecular interactions.

Human

HEK293

C-hFc

Q5VY80 (R26-S217)

154064  [NCBI]

Partial

RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.