UNG Protein, Human (His)

UNG Protein excises uracil residues from DNA, addressing misincorporation of dUMP by DNA polymerase or cytosine deamination. UNG Protein, Human (His) is the recombinant human-derived UNG protein, expressed by E. coli , with N-His labeled tag. The total length of UNG Protein, Human (His) is 220 a.a., with molecular weight of ~26 kDa.

UNG protein, an essential component in DNA repair mechanisms, performs the crucial function of excising uracil residues from DNA strands. These uracil residues may arise from the erroneous incorporation of dUMP residues by DNA polymerase or the deamination of cytosine. By recognizing and removing these uracil lesions, UNG plays a pivotal role in maintaining the integrity of the genetic material, contributing to the fidelity of DNA replication, and preventing the accumulation of mutations that could compromise genomic stability.

Human

E. coli

N-His

P13051-2 (F85-L304)

7374  [NCBI]

FGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

Approximately 26 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.