UNG Protein, Human (His)
Based on 1 Customer Validation
UNG Protein excises uracil residues from DNA, addressing misincorporation of dUMP by DNA polymerase or cytosine deamination. UNG Protein, Human (His) is the recombinant human-derived UNG protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UNG Protein excises uracil residues from DNA, addressing misincorporation of dUMP by DNA polymerase or cytosine deamination. UNG Protein, Human (His) is the recombinant human-derived UNG protein, expressed by E. coli , with N-His labeled tag.
Background
UNG protein, an essential component in DNA repair mechanisms, performs the crucial function of excising uracil residues from DNA strands. These uracil residues may arise from the erroneous incorporation of dUMP residues by DNA polymerase or the deamination of cytosine. By recognizing and removing these uracil lesions, UNG plays a pivotal role in maintaining the integrity of the genetic material, contributing to the fidelity of DNA replication, and preventing the accumulation of mutations that could compromise genomic stability.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P13051-2 (F85-L304)
-
Molecular Construction
-
N-term
-
His
-
UNG (F85-L304)
Accession # P13051-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
UNG; Uracil DNA Glycosylase; DGU; UNG1; UDG; Uracil-DNA Glycosylase; HIGM4; UNG2; Uracil-DNA Glycosylase 1,Uracil-DNA Glycosylase 2; UNG15; Uncharacterized Protein DKFZp781L1143; DKFZp781L1143; HIGM5
-
AA Sequence
FGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
-
Predicted Molecular Mass
25 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
