UROD Protein, Human (His)
UROD proteins catalyze the sequential decarboxylation of the acetate side chain of uroporphyrinogen to form coproporphyrinogen and contribute to the fifth step of the heme biosynthetic pathway. UROD Protein, Human (His) is the recombinant human-derived UROD protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
UROD proteins catalyze the sequential decarboxylation of the acetate side chain of uroporphyrinogen to form coproporphyrinogen and contribute to the fifth step of the heme biosynthetic pathway. UROD Protein, Human (His) is the recombinant human-derived UROD protein, expressed by E. coli , with N-6*His labeled tag.
UROD protein plays a crucial role in the heme biosynthetic pathway by catalyzing the sequential decarboxylation of the four acetate side chains of uroporphyrinogen, resulting in the formation of coproporphyrinogen. Both isomer I and isomer III of uroporphyrinogen may serve as substrates, but only coproporphyrinogen III can be further converted to heme. This enzymatic process represents the fifth step in heme biosynthesis and is essential for the production of this critical component involved in various physiological functions. Additionally, in vitro experiments demonstrate UROD's capability to decarboxylate pentacarboxylate porphyrinogen I, underscoring its versatility in substrate specificity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P06132 (M1-N367)
-
Molecular Construction
-
N-term
-
6*His
-
UROD (M1-N367)
Accession # P06132 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UROD; Uroporphyrinogen Decarboxylase; UPD; Uroporphyrinogen III Decarboxylase; URO‑D; PCT
-
AA Sequence
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
-
Predicted Molecular Mass
43 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)