VEGF145 Protein, Human (HEK293)

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

VEGF145 Protein, characterized by limited expression, is not widely distributed across tissues or cell types. The restricted occurrence of VEGF145 suggests a specialized and possibly context-specific role in physiological processes. Further investigation is warranted to uncover the specific cellular contexts and functions in which VEGF145 is actively involved, shedding light on its potential contributions to localized biological activities.

Human

HEK293

Tag Free

P15692-6 (A27-R171)

7422  [NCBI]

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Approximately 16.92 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.