Vitronectin Protein, Human (HEK293, His)

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Vitronectin Protein, Human (HEK293, His) is 459 a.a., with molecular weight of 60-80 kDa.

Vitronectin Protein is a multifunctional cell adhesion and spreading factor present in serum and tissues. It interacts with glycosaminoglycans and proteoglycans and acts as a cell-to-substrate adhesion molecule, binding to specific integrins. Additionally, Vitronectin Protein functions as an inhibitor of the terminal cytolytic complement pathway, protecting cell membranes from damage. It also possesses protease-inhibiting activity and is involved in regulating growth hormone-dependent processes, specifically somatomedin-B.

1.Immobilized Human Vitronectin, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Mouse ITGAV&ITGB3, His Tag with the EC₅₀ of ≤1.72 μg/mL determined by ELISA.
2.Measured by the ability of the immobilized protein to support the adhesion of B16‑F1 mouse melanoma cells. When 5x10⁴ cells/well are added to Vitronectin coated plates (5 µg/mL with 100 µL/well), approximately is 78.525% will adhere after 30 minutes at 37 °C.

Human

HEK293

C-6*His

P04004/AAH05046.1 (D20-L478)

7448  [NCBI]

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

approximately 60-80 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE or Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.